Phrixotoxin-3, Voltage-gated Na+ channel blocker (ab141845)
Key features and details
- Voltage-gated Na+ channel blocker
- CAS Number:
- Purity: > 99%
- Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
Phrixotoxin-3, Voltage-gated Na+ channel blocker -
Description
Voltage-gated Na+ channel blocker -
Purity
> 99% -
Chemical structure
Properties
-
Molecular weight
4060.00 -
Molecular formula
C176H269N51O48S6 -
Sequence
DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI (Modifications: Disulfide bonds: 2-17, 9-23, 16-30) -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min). -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one month. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas
Images
-
Functional Studies - Phrixotoxin-3, Voltage-gated Na+ channel blocker (ab141845)Phrixotoxin-3 inhibits NaV1.2 channels heterologously expressed in Xenopus oocytes.
Superimposed traces of NaV1.2 currents before (green) and during (black) application of 300 nM Phrixotoxin-3 (ab141845). Currents were elicited from a holding potential of -100 mV and test pulses of 35 ms to +60 mV were delivered every 5 sec.