Native human Cathepsin D protein (ab91123)
Key features and details
- Expression system: Native
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE, WB
-
Product name
Native human Cathepsin D protein
See all Cathepsin D proteins and peptides -
Biological activity
Activity: >=300 units per mg protein. One unit is defined as the amount of enzyme that digests hemoglobin-releasing peptides which are soluble in 10% TCA. The reaction is measured by an increase of an A280 of 1.0 per 60 minutes at 37°C . Substrate: acid denatured hemoglobin, pH 1.8 (0.2% in reaction mixture). Buffer: 100 mM formate, pH 3.3. -
Purity
> 95 % SDS-PAGE. -
Expression system
Native -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Native -
-
Species
Human -
Sequence
MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKG PVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGS SNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGY LSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILG MAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGT DSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLS PEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRD NNRVGFAEAARL -
Additional sequence information
Source: Human Plasma
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C.
pH: 6.50
Constituent: 0.0328% Sodium phosphateThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionResuspend a 25ug vial with 71.4uL of deionized H2O to give a protein concentration of 0.350mg/mL, which is the original protein concentration of the lot when it was finished. This should then be aliquotted into suitable amounts in a screw top vial to prevent sublimation and stored at
General Info
-
Alternative names
- CatD
- CATD_HUMAN
- Cathepsin D
see all -
Function
Acid protease active in intracellular protein breakdown. Involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease. -
Tissue specificity
Expressed in the aorta extrcellular space (at protein level). -
Involvement in disease
Ceroid lipofuscinosis, neuronal, 10 -
Sequence similarities
Belongs to the peptidase A1 family.
Contains 1 peptidase A1 domain. -
Post-translational
modificationsN- and O-glycosylated. -
Cellular localization
Lysosome. Melanosome. Secreted, extracellular space. Identified by mass spectrometry in melanosome fractions from stage I to stage IV. In aortic samples, detected as an extracellular protein loosely bound to the matrix (PubMed:20551380). - Information by UniProt
Images
-
SDS-PAGE: 4-12% Bis-Tris NuPAGE gel
Lane 1. Molecular weight markers
Lane 2. 4 μg Cathepsin D (non-reduced/no heat)
Lane 3. 7 μg Cathepsin D (non-reduced/no heat)
Lane 4. Molecular weight markers
Lane 5. 4 μg Cathepsin D (reduced/heated)
Lane 6. 7 μg Cathepsin D (reduced/heated)
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (1)
ab91123 has been referenced in 1 publication.
- Brings S et al. Urinary cathepsin L is predictive of changes in albuminuria and correlates with glucosepane in patients with type 2 diabetes in a closed-cohort study. J Diabetes Complications N/A:107648 (2020). PubMed: 32532588
-
Images
-
SDS-PAGE: 4-12% Bis-Tris NuPAGE gel
Lane 1. Molecular weight markers
Lane 2. 4 μg Cathepsin D (non-reduced/no heat)
Lane 3. 7 μg Cathepsin D (non-reduced/no heat)
Lane 4. Molecular weight markers
Lane 5. 4 μg Cathepsin D (reduced/heated)
Lane 6. 7 μg Cathepsin D (reduced/heated)