Native Cow 20S Immunoproteasome protein (ab218003)
Key features and details
- Expression system: Native
- Purity: > 95% SDS-PAGE
- Suitable for: SDS-PAGE, Functional Studies
-
Product name
Native Cow 20S Immunoproteasome protein -
Purity
> 95 % SDS-PAGE. -
Expression system
Native -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Native -
-
Species
Cow -
Sequence
MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGKDIVVLGVEKKSV AKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVED PVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPS GTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQ SGGKNIELAVMRRDQPLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS -
Predicted molecular weight
700 kDa -
Amino acids
1 to 248 -
Additional sequence information
Purified from bovine red blood cells.
-
Preparation and Storage
- Proteasome subunit alpha type-7
- Proteasome subunit RC6-1
- Proteasome subunit XAPC7
Images
-
SDS-PAGE - Native Cow 20S Immunoproteasome protein (ab218003)
Coomassie-stained SDS-PAGE analysis of ab218003 (5 μg).
-
SDS-PAGE - Native Cow 20S Immunoproteasome protein (ab218003)Coomassie-stained native-PAGE analysis of ab218003 (5 μg).
-
ELISA - Native Cow 20S Immunoproteasome protein (ab218003)Activation of 5 nM ab218003 by 25 nM PA28γ, the proteasome activity was assayed by using 50 µM Suc-LLVY-AMC as the substrate. The AMC fluorescence was monitored by a plate reader with excitation and emission filters of 360±40 nm and 460±30 nm, respectively.
-
ELISA - Native Cow 20S Immunoproteasome protein (ab218003)Activation of 5 nM ab218003 by 25 nM PA28β, the proteasome activity was assayed by using 50 µM Suc-LLVY-AMC as the substrate. The AMC fluorescence was monitored by a plate reader with excitation and emission filters of 360±40 nm and 460±30 nm, respectively.
-
ELISA - Native Cow 20S Immunoproteasome protein (ab218003)Activation of 5 nM ab218003 by 25 nM PA28α, the proteasome activity was assayed by using 50 µM Suc-LLVY-AMC as the substrate. The AMC fluorescence was monitored by a plate reader with excitation and emission filters of 360±40 nm and 460±30 nm, respectively.