Human Parathyroid Hormone peptide (ab42334)
Key features and details
- Purity: > 95% SDS-PAGE
- Suitable for: Blocking
-
Product name
Human Parathyroid Hormone peptide
See all Parathyroid Hormone proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Animal free
No -
Nature
Synthetic -
-
Species
Human -
Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF -
Amino acids
1 to 34
-
Preparation and Storage
-
Alternative names
- hPTH
- Parathormone
- Parathyrin
see all -
Function
PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells. -
Involvement in disease
Defects in PTH are a cause of familial isolated hypoparathyroidism (FIH) [MIM:146200]; also called autosomal dominant hypoparathyroidism or autosomal dominant hypocalcemia. FIH is characterized by hypocalcemia and hyperphosphatemia due to inadequate secretion of parathyroid hormone. Symptoms are seizures, tetany and cramps. FIH exist both as autosomal dominant and recessive forms of hypoparathyroidism. -
Sequence similarities
Belongs to the parathyroid hormone family. -
Cellular localization
Secreted. - Information by UniProt
