Heteropodatoxin-2 (HpTX2), Kv4.3 voltage-gated K+ channel blocker (ab141874)
Key features and details
- Specific Kv4.3 voltage-gated K+ channel blocker
- CAS Number:
- Purity: > 98%
- Soluble in water
- Form / State: Solid
- Source: Heteropoda venatoria
Overview
-
Product name
Heteropodatoxin-2 (HpTX2), Kv4.3 voltage-gated K+ channel blocker -
Description
Specific Kv4.3 voltage-gated K+ channel blocker -
Biological description
Specific Kv4.3 voltage-gated K+ channel blocker. Peptide toxin. Acts as a gating modifier of the Kv4.1 channel. Lacks affinity for Kv1.4, Kv2.1, and Kv3.4 channels. -
Purity
> 98% -
Chemical structure

Properties
-
Molecular weight
3413.00 -
Molecular formula
C144H213N39O46S6 -
Sequence
DDCGKLFSGCDTNADCCEGYVCRLWCKLDW (Modifications: C-terminal amide; Disulfide bonds: 3-17, 10-22, 16-26) -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Heteropoda venatoria
-
Research areas
Images
-
Heteropodatoxin-2 inhibits KV4.2 channel currents expressed in Xenopus oocytes.
Currents were elicited by application of voltage step from a holding potential of -100 mV to 0 mV in 100 msec, delivered every 10 seconds. A. Time course of channel activity (current amplitude at +0 mV), before (black) and during (green) application of 100 nM Heteropodatoxin-2 (ab141874). B. Example of superimposed current traces before (black) and during (green) application of 100 nM Heteropodatoxin-2, taken from the experiment in A.