ADWX-1, KV1.3 channel blocker (ab145529)
Key features and details
- Highly potent, selective KV1.3 channel blocker
- CAS Number:
- Purity: > 98%
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
ADWX-1, KV1.3 channel blocker -
Description
Highly potent, selective KV1.3 channel blocker -
Biological description
Highly potent, selective KV1.3 channel blocker (IC50 values = 0.0019 nM and 0.65 nM for KV1.3 and KV1.1, respectively). Inhibits CD4+ CCR7- T cell activation. Shows immunomodulatory effects in vivo. -
Purity
> 98% -
Chemical structure

Properties
-
Molecular weight
4071.85 -
Molecular formula
C169H281N57O46S7 -
Sequence
VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK (Modifications: Disulfide bonds: 7-27, 13-32, 17-34) -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas