Guangxitoxin-1E, Specific Kv2.1 channel blocker (ab141872)
Key features and details
- Specific Kv2.1 channel blocker
- CAS Number:
- Purity: > 98%
- Soluble in water
- Form / State: Solid
- Source: Plesiophrictus guangxiensis
Overview
-
Product name
Guangxitoxin-1E, Specific Kv2.1 channel blocker -
Description
Specific Kv2.1 channel blocker -
Biological description
Specific Kv2.1 channel blocker. Stimulates insulin secretion in vitro. -
Purity
> 98% -
Chemical structure
Properties
-
Molecular weight
3948.70 -
Molecular formula
C178H248N44O45S7 -
Sequence
EGECGGFWWKCGSGKPACCPKYVCSPKWGLCNFPMP (Modifications: Disulfide bonds: 4-19, 11-24, 18-31) -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Plesiophrictus guangxiensis
-
Research areas
Images
-
Functional Studies - Guangxitoxin-1E, Specific Kv2.1 channel blocker (ab141872)Guangxitoxin-1E inhibits KV2.1 channel currents expressed in Xenopus oocytes.
Currents were elicited by application of voltage ramp from a holding potential of -80 mV to 60 mV in 100 msec, delivered every 10 seconds. A. Time course of channel activity (current amplitude at +40 mV), before (black) and during (green) application of 100 nM Guangxitoxin-1E (ab141872). B. Top, illustration of the voltage ramp protocol. Bottom, example of superimposed current traces before (black) and during (green) application of 100 nM Guangxitoxin-1E, taken from the experiment in A.