Exendin (9-39) amide, GLP-1 receptor antagonist (ab141101)
Key features and details
- Potent, selective GLP-1 receptor antagonist
- CAS Number: 133514-43-9
- Purity: > 98%
- Soluble in water
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
Exendin (9-39) amide, GLP-1 receptor antagonist -
Description
Potent, selective GLP-1 receptor antagonist -
Biological description
Potent, selective GLP-1 receptor antagonist (Kd = 1.7 nM). Inhibits the generation of intracellular cAMP induced by GLP-1 (7-36), exendin-3 and exendin-4 (ab120214). Role in appetite modulation, water and salt homeostasis and insulin release. Active in vivo.
-
Purity
> 98% -
CAS Number
133514-43-9 -
Chemical structure

Properties
-
Molecular weight
3369.79 -
Molecular formula
C149H234N40O47S -
Sequence
DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (Modifications: C-terminal amide) -
PubChem identifier
129012199 -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas