Dendrotoxin-K, KV1.1 blocker (ab141795)
Key features and details
- Highly selective, potent KV1.1 blocker
- CAS Number: 119128-61-9
- Purity: > 98%
- Soluble in water
- Form / State: Solid
- Source: Dendroaspis polylepis polylepis (Black mamba).
Overview
-
Product name
Dendrotoxin-K, KV1.1 blocker -
Description
Highly selective, potent KV1.1 blocker -
Biological description
Highly selective, potent KV1.1 blocker. Exclusively blocks the single cloned KV1.1 channels as opposed to dendrotoxins I, α, β and γ (Asc 1791, 1792, 1793 and 1794). Differentially blocks heteromers of KV1.1/1.X with variable affinity in different neuronal subtypes. -
Purity
> 98% -
CAS Number
119128-61-9 -
Chemical structure
Properties
-
Molecular weight
6560.00 -
Molecular formula
C294H462N84O75S6 -
Sequence
AAKYCKLPLRIGPCKRKIPSFYYKWKAKQCLPFDYSGCGGNANRFKTIEECRRTCVG (Modifications: Disulfide bonds: 5-55, 14-38, 30-51) -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Dendroaspis polylepis polylepis (Black mamba).
-
Research areas
Images
-
Functional Studies - Dendrotoxin-K, KV1.1 blocker (ab141795)Dendrotoxin-K inhibits KV1.1 channel currents heterologously expressed in Xenopus oocytes.
A.Time course at plateau of Dendrotoxin-K (ab141795) action on KV1.1 currents. Current amplitude at plateau was plotted as a function of time. Membrane potential was held at -80 mV and oocytes were stimulated by a 100 ms voltage ramp to -10 mV. 1 nM Dendrotoxin-K (applied for 2 min, green) were perfused during the period marked by the bar, (as indicated) and showed 70-80% inhibition of control current. B. Superimposed traces of channel current in the absence (black) and presence (green) of 1 nM Dendrotoxin-K (taken from experiment in A).