Biotin Anti-Uricase antibody (ab181760)
Key features and details
- Biotin Goat polyclonal to Uricase
- Conjugation: Biotin
- Isotype: IgG
Overview
-
Product name
Biotin Anti-Uricase antibody -
Description
Biotin Goat polyclonal to Uricase -
Host species
Goat -
Conjugation
Biotin -
Species reactivity
Reacts with: Other species -
Immunogen
Full length native protein (purified) corresponding to Uricase aa 1-341. Bacillus spp.
Sequence:MVSLRSVHQTTERVGVEVENKRTMSYGKGNVFAYRTFMEPLSGLQPIPES AFTVRDNTVFGINVTVEVGGNAFLSSFTDGDNQMVVATDSMKNFIQRHLA TFSGRTIEGFIRYVGEAFLTTYSHIDWVKLTGEAVPFENTTYANGEESST SSLVYKHSRNERNEASIELVREGNGWQINSQNSRLLDLQLVKVKDNSFVG FIRDQYTTLPEDSNRPLFIYLNIGWSYETDDDALGEEPARYVAGEQVADL ASSVFHELTSPSIQHLIYQIGCRMLKRFPQLQEVTFESQNRTWDTVVEDI PETEGKVYTEPRLPFGFQRFSVTKADLGPQTTSARTEKARL
Database link: YP_177228.1 -
Positive control
- Bacillus spp. Uricase protein.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark. -
Storage buffer
Preservative: 0.01% Sodium azide
Constituents: 0.27% Potassium phosphate, 0.88% Sodium chloride, 1% BSA
Immunoglobulin and protease free. -
Concentration information loading...
-
Purity
IgG fraction -
Purification notes
ab181760 is an IgG fraction antibody purified from monospecific antiserum by a multi-step process which includes delipidation, salt fractionation and ion exchange chromatography followed by extensive dialysis against the buffer stated above. Assay by immunoelectrophoresis resulted in a single precipition arc against anti-Biotin anti-Goat Serum as well as purified and partially purified Bacillus spp. Uricase. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas