beta-Amyloid Peptide (1-40) (rat/mouse) (ab120957)
Key features and details
- Rat form of the beta-Amyloid (1-40) peptide
- CAS Number: 144409-98-3
- Soluble in 0.1% NH4OH to 1 mg/ml
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
beta-Amyloid Peptide (1-40) (rat/mouse) -
Description
Rat form of the beta-Amyloid (1-40) peptide -
CAS Number
144409-98-3 -
Chemical structure
Properties
-
Molecular weight
4233.76 -
Molecular formula
C190H291N51O57S -
Sequence
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in 0.1% NH4OH to 1 mg/ml -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas