ATX-II, NaV channel activator (ab141870)
Key features and details
- Potent NaV channel activator
- CAS Number: 60748-45-0
- Purity: > 98%
Soluble in water
- Form / State: Solid
- Source: Anemonia sp.
Overview
-
Product name
ATX-II, NaV channel activator -
Description
Potent NaV channel activator -
Biological description
Potent NaV channel activator (IC50 = 10-100 nM). Selectively enhances sodium currents in A-fibre-related DRG cells. Algesic and pruritic effects in vivo. -
Purity
> 98% -
CAS Number
60748-45-0 -
Chemical structure
Properties
-
Molecular weight
4935.00 -
Molecular formula
C213H323N63O61S6 -
Sequence
GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ (Modifications: Disulfide bonds: 4-44, 6-34, 27-45) -
PubChem identifier
56841750 -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water
-
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Anemonia sp.
-
Research areas
Images
-
Functional Studies - ATX-II, NaV channel activator (ab141870)
ATX-II (ab141870) enhances hNav1.5 currents in stably transfected HEK cells. hNav1.5 currents were elicited by a 50 ms voltage step from the holding potential of -100 mV to -20 mV, applied every 20 seconds, using whole-cell voltage clamp technique (bath solution contains TEA and pipette solution contains CsF). A. Time course, showing the effect of 0.05 nM, 0.5 nM, 5 nM and 50 nM ATX-II (ab141870) on the current area, indicating a dose-dependent slowing of the hNav1.5 inactivation. B. Superimposed traces of hNav1.5 currents under control conditions and after 4-6 min perfusion with 0.05 nM, 0.5 nM, 5 nM and 50 nM ATX-II, as indicated.