APETx2, ASIC3 channel blocker (ab141849)
Key features and details
- Selective, reversible ASIC3 channel blocker
- CAS Number: 713544-47-9
- Purity: > 98%
- Soluble in water to 1 mg/ml
- Form / State: Solid
- Source: Anthopleura elegantissima
Overview
-
Product name
APETx2, ASIC3 channel blocker -
Description
Selective, reversible ASIC3 channel blocker -
Biological description
Selective, reversible ASIC3 channel blocker (IC50 = 63 nM). Inhibits heteromeric ASIC2b and ASIC3 currents (IC50 = 117 nM) and NaV1.8 channels (IC50 = 2.6 μM). Shows analgesic effects in vivo.
-
Purity
> 98% -
CAS Number
713544-47-9 -
Chemical structure

Properties
-
Molecular weight
4561.05 -
Molecular formula
C196H280N54O61S6 -
Sequence
GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD (Modifications: Disulfide bonds: 4-37, 6-30, 20-38) -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water to 1 mg/ml -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Anthopleura elegantissima
-
Research areas
Images
-
APETx2 blocks inward currents of ASIC3 channels expressed in Xenopus oocytes.
Membrane potential was held at 5 mV and whole cell current was continuously recorded. ASIC3 currents were elicited by rapid exposure to pH 5 in physiological solution every 20 sec. 1 µM APETx2 (ab141849) was introduced into the bath via perfusion, resulting in a reversible inhibition of the pH dependent inward transients.