Apelin 36 (human), Endogenous apelin receptor (APJ) agonist (ab141009)
Key features and details
- Endogenous apelin receptor (APJ) agonist
- CAS Number: 252642-12-9
Soluble in water to 10 mg/ml
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
Apelin 36 (human), Endogenous apelin receptor (APJ) agonist -
Description
Endogenous apelin receptor (APJ) agonist -
Biological description
Endogenous apelin receptor (APJ) agonist (EC50 = 20 nM). Exhibits cardioprotective effect and inhibits entry of HIV-1 and HIV-2 into NP-2/CD4 cells. Active in vivo.
-
CAS Number
252642-12-9 -
Chemical structure
Properties
-
Molecular weight
4195.87 -
Molecular formula
C184H297N69O43S -
Sequence
LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water to 10 mg/ml
-
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas