Anti-YME1L1 antibody (ab170123)
Key features and details
- Rabbit polyclonal to YME1L1
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-YME1L1 antibody
See all YME1L1 primary antibodies -
Description
Rabbit polyclonal to YME1L1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human YME1L1 aa 395-600.
Sequence:MHPYSRQTINQLLAEMDGFKPNEGVIIIGATNFPEALDNALIRPGRFDMQ VTVPRPDVKGRTEILKWYLNKIKFDQSVDPEIIARGTVGFSGAELENLVN QAALKAAVDGKEMVTMKELEFSKDKILMGPERRSVEIDNKNKTITAYHES GHAIIAYYTKDAMPINKATIMPRGPTLGHVSLLPENDRWNETRAQLLAQM DVSMGG
Database link: BC023507 -
Positive control
- WB: HepG2 and MCF7 cell lysates; IHC-P: Human colon cancer tissue.
-
General notes
Previously labelled as ATP-dependent metalloprotease YME1L1.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Lyophilized:Reconstitute with 200ul distilled sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-YME1L1 antibody (ab170123) at 1/500 dilution
Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
Lane 2 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
Predicted band size: 86 kDa
Observed band size: 86 kDa
Additional bands at: 50 kDa (possible mature (processed) protein)
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-YME1L1 antibody (ab170123)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human colon cancer tissue labeling YME1L1 with ab170123 at 1/100 dilution.