Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category

Anti-Wilms Tumor Protein antibody (ab180840)

Price and availability

291 484 ₸

Availability

Order now and get it on Thursday February 25, 2021

Anti-Wilms Tumor Protein antibody (ab180840)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to Wilms Tumor Protein
  • Suitable for: WB, IHC-P, ICC/IF
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Recombinant Tick-Borne Encephalitis Virus NS1 protein (His tag) (ab218554)
Product image
Anti-CRISPR-Cas9 antibody (ab204448)
Product image
Anti-S31 antibody (ab140506)
Product image
Anti-AVEN antibody [EP4721] (ab108354)

Overview

  • Product name

    Anti-Wilms Tumor Protein antibody
    See all Wilms Tumor Protein primary antibodies
  • Description

    Rabbit polyclonal to Wilms Tumor Protein
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Pig
  • Immunogen

    Recombinant full length protein corresponding to Human Wilms Tumor Protein aa 1-302.
    Sequence:

    MEKGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYS VPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLG ATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHTHGVF RGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHS RKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSR SDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQL AL


    Database link: P19544-6
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: Human kidney and rat kidney tissue lysates. A549 and MCF7 cell lysates IHC-P: Human lung, human kidney and rat testis tissues.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Tags & Cell Markers
    • Cell Type Markers
    • Tumor Associated
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Other factors
    • Cancer
    • Tumor biomarkers
    • Other
    • Developmental Biology
    • Organogenesis
    • Excretory system development
    • Kidney development

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Wilms Tumor Protein antibody (ab180840)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Wilms Tumor Protein antibody (ab180840)

    Immunohistochemical analysis of paraffin-embedded human liver injury using WT1 antibody (ab180840) at dilution of 1/100.

  • Western blot - Anti-Wilms Tumor Protein antibody (ab180840)
    Western blot - Anti-Wilms Tumor Protein antibody (ab180840)
    All lanes : Anti-Wilms Tumor Protein antibody (ab180840) at 1/500 dilution

    Lane 1 : A549 cell lysate
    Lane 2 : MCF7 cell lysate
    Lane 3 : Mouse heart tissue lysate
    Lane 4 : Mouse testis tissue lysate

    Lysates/proteins at 25 µg per lane.

    Secondary
    All lanes : HRP Goat Anti-Rabbit IgG (H+L) at 1/10000 dilution

    Observed band size: 49 kDa
    why is the actual band size different from the predicted?



    Blocking buffer: 3% nonfat dry milk in TBST.

     

  • Immunocytochemistry/ Immunofluorescence - Anti-Wilms Tumor Protein antibody (ab180840)
    Immunocytochemistry/ Immunofluorescence - Anti-Wilms Tumor Protein antibody (ab180840)

    Immunocytochemistry/ Immunofluorescence analysis of HeLa cells using WT1 antibody (ab180840). Blue: DAPI for nuclear staining.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Wilms Tumor Protein antibody (ab180840)

  •  
  • Product image

    Anti-Wilms Tumor Protein antibody [SP321] - BSA and Azide free (ab242425)

    Applications: Flow Cyt, IHC-P, WB

  •  
  • Product image

    Anti-Wilms Tumor Protein antibody [CAN-R9(IHC)-56-2] - BSA and Azide free (ab216646)

    Applications: Flow Cyt, ICC, IHC-P, WB

  •  
  • Product image

    FITC Anti-Wilms Tumor Protein antibody [CAN-R9(IHC)-56-2] (ab223934)

    Applications: ICC/IF

  •  
  • Product image

    Alexa Fluor® 647 Anti-Wilms Tumor Protein antibody [CAN-R9(IHC)-56-2] (ab202639)

    Applications: ICC/IF

  •  
  • Product image

    Alexa Fluor® 488 Anti-Wilms Tumor Protein antibody [CAN-R9(IHC)-56-2] (ab202635)

    Applications: ICC/IF

  •  
  • Product image

    Anti-Wilms Tumor Protein antibody [SP320] - BSA and Azide free (ab242423)

    Applications: Flow Cyt, IHC-P

Clear all

Recently viewed products

  •  
  • Product image

    Anti-PKM antibody [EPR10139] (ab154816)

  •  
  • Product image

    Anti-SUN3 antibody [EPR12910] (ab181063)

  •  
  • Product image

    Anti-TICAM2 antibody [mAbcam77169] (ab77169)

  •  
  • Product image

    Anti-Angiotensin II Type 2 Receptor antibody (ab19134)

  •  
  • Product image

    Anti-Phospholipase c eta 1 antibody (ab97750)

  •  
  • Product image

    Human HSP90AA1 (Hsp90 alpha) knockout HEK-293T cell lysate (ab258458)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.