Anti-Wilms Tumor Protein antibody (ab180840)
Key features and details
- Rabbit polyclonal to Wilms Tumor Protein
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-Wilms Tumor Protein antibody
See all Wilms Tumor Protein primary antibodies -
Description
Rabbit polyclonal to Wilms Tumor Protein -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Pig -
Immunogen
Recombinant full length protein corresponding to Human Wilms Tumor Protein aa 1-302.
Sequence:MEKGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYS VPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLG ATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHTHGVF RGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHS RKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSR SDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQL AL
Database link: P19544-6 -
Positive control
- WB: Human kidney and rat kidney tissue lysates. A549 and MCF7 cell lysates IHC-P: Human lung, human kidney and rat testis tissues.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemical analysis of paraffin-embedded human liver injury using WT1 antibody (ab180840) at dilution of 1/100.
-
All lanes : Anti-Wilms Tumor Protein antibody (ab180840) at 1/500 dilution
Lane 1 : A549 cell lysate
Lane 2 : MCF7 cell lysate
Lane 3 : Mouse heart tissue lysate
Lane 4 : Mouse testis tissue lysate
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : HRP Goat Anti-Rabbit IgG (H+L) at 1/10000 dilution
Observed band size: 49 kDa why is the actual band size different from the predicted?Blocking buffer: 3% nonfat dry milk in TBST. -
Immunocytochemistry/ Immunofluorescence analysis of HeLa cells using WT1 antibody (ab180840). Blue: DAPI for nuclear staining.