Anti-WDR48/UAF1 antibody (ab122473)
Key features and details
- Rabbit polyclonal to WDR48/UAF1
- Suitable for: IHC-P, ICC
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-WDR48/UAF1 antibody
See all WDR48/UAF1 primary antibodies -
Description
Rabbit polyclonal to WDR48/UAF1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICCmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human WDR48/UAF1 aa 362-450 (internal sequence).
Sequence:SIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRF KMVYVPNWFSVDLKTGMLTITLDESDCFAAWVSAKDAGF
-
Positive control
- IHC-P: Human testis, endometrium, cerebral cortex, and cervix tissues; ICC: A431 cells.
-
General notes
This product was previously labelled as WDR48
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-WDR48/UAF1 antibody (ab122473)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human testis tissue labelling WDR48/UAF1 with ab122473 at 1/50 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
ab122473, at 4 µg/ml, staining WDR48/UAF1 in PFA/Triton X-100 fixed/permeabilized A431 cells by Immunofluorescence (green).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-WDR48/UAF1 antibody (ab122473)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human endometrium tissue labelling WDR48/UAF1 with ab122473 at 1/50 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-WDR48/UAF1 antibody (ab122473)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human cerebral cortex tissue labelling WDR48/UAF1 with ab122473 at 1/50 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-WDR48/UAF1 antibody (ab122473)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human cervix tissue labelling WDR48/UAF1 with ab122473 at 1/50 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.

