Anti-UBXN2B antibody [OTI3H8] (ab124032)
Key features and details
- Mouse monoclonal [OTI3H8] to UBXN2B
- Suitable for: WB, Flow Cyt
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-UBXN2B antibody [OTI3H8] -
Description
Mouse monoclonal [OTI3H8] to UBXN2B -
Host species
Mouse -
Tested applications
Suitable for: WB, Flow Cytmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human UBXN2B aa 2-331. Produced in HEK293T cells (NP_001071087).
Sequence:AEGGGPEPGEQERRSSGPRPPSARDLQLALAELYEDEVKCKSSKSNRPKA TVFKSPRTPPQRFYSSEHEYSGLNIVRPSTGKIVNELFKEAREHGAVPLN EATRASGDDKSKSFTGGGYRLGSSFCKRSEYIYGENQLQDVQILLKLWSN GFSLDDGELRPYNEPTNAQFLESVKRGEIPLELQRLVHGGQVNLDMEDHQ DQEYIKPRLRFKAFSGEGQKLGSLTPEIVSTPSSPEEEDKSILNAVVLID DSVPTTKIQIRLADGSRLIQRFNSTHRILDVRNFIVQSRPEFAALDFILV TSFPNKELTDESLTLLEADILNTVLLQQLK
Database link: Q14CS0 -
Positive control
- WB: HEK293T cell lysate transfected with pCMV6-ENTRY UBXN2B cDNA; HepG2, HeLa, HT29, A549, COS-7, Jurkat, MDCK and MCF7 cell extracts Flow Cyt: HEK293T cells transfected with a UBXN2B overexpress plasmid
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography -
Clonality
Monoclonal -
Clone number
OTI3H8 -
Isotype
IgG1 -
Research areas
Images
-
All lanes : Anti-UBXN2B antibody [OTI3H8] (ab124032) at 1/1000 dilution
Lane 1 : Human testis tissue extract
Lane 2 : Human omentum tissue extract
Lane 3 : Human uterus tissue extract
Lane 4 : Human breast tissue extract
Lane 5 : Human brain tissue extract
Lane 6 : Human liver tissue extract
Lane 7 : Human ovary tissue extract
Lane 8 : Human thyroid gland tissue extract
Lane 9 : Human colon tissue extract
Lane 10 : Human spleen tissue extract
Predicted band size: 37 kDa
-
All lanes : Anti-UBXN2B antibody [OTI3H8] (ab124032) at 1/1000 dilution
Lane 1 : HEK293T cell lysate transfected with pCMV6-ENTRY control
Lane 2 : HEK293T cell lysate transfected with pCMV6-ENTRY UBXN2B cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 37 kDa
HEK293T cell lysates were generated from transient transfection of the cDNA clone (RC205243) -
ab124032, at a 1/100 dilution, staining UBXN2B in HEK293T cells transfected with a UBXN2B overexpress plasmid (Red) or empty vector control plasmid (Blue) by Flow Cytometry.