Anti-UBE3D antibody (ab121927)
Key features and details
- Rabbit polyclonal to UBE3D
- Suitable for: ICC, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-UBE3D antibody -
Description
Rabbit polyclonal to UBE3D -
Host species
Rabbit -
Tested applications
Suitable for: ICC, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human UBE3D.
Sequence:SLVIESLRNSKYIKKFPLLENTFKADSSSAWSAVKVLYQPCIKSRNEKLV SLWESDISVHPLTLPSATCLELLL
-
Positive control
- ICC: RH-30 cells; IHC-P: Human skeletal muscle, kidney, lung, and urinary bladder tissues.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UBE3D antibody (ab121927)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human skeletal muscle tissue labelling UBE3D with ab121927 at 1/20 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunocytochemistry analysis of RH-30 (human bone marrow metastasis cell line) cells labeling UBE3D with ab121927 at 2 µg/mL. Cells treated with PFA/Triton X-100.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UBE3D antibody (ab121927)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung tissue labelling UBE3D with ab121927 at 1/20 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UBE3D antibody (ab121927)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling UBE3D with ab121927 at 1/20 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UBE3D antibody (ab121927)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human urinary bladder tissue labelling UBE3D with ab121927 at 1/20 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.