Anti-UBE2E3 antibody [OTI4B4] (ab128098)
Key features and details
- Mouse monoclonal [OTI4B4] to UBE2E3
- Suitable for: WB, IHC-P, Flow Cyt, ICC/IF
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-UBE2E3 antibody [OTI4B4]
See all UBE2E3 primary antibodies -
Description
Mouse monoclonal [OTI4B4] to UBE2E3 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanICC/IF HumanIHC-P HumanWB Human -
Immunogen
Recombinant full length protein corresponding to Human UBE2E3 aa 1-207. (NP_006348) produced in E.coli.
Sequence:MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTK LSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGP PGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILK DNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQ WTKRYAT
Database link: Q969T4 -
Positive control
- WB: HepG2 extracts; HEK-293T cells transiently transfected with the UBE2E3 cDNA. IHC-P: Human endometrium adenocarcinoma tissue. ICC/IF: HepG2 cells. Flow Cyt: HeLa and Jurkat cells; HEK-293T cells transfected with UBE2E3 overexpressing plasmid.
-
General notes
Clone OTI4B4 (formerly 4B4).
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 1% BSA, 50% Glycerol -
Concentration information loading... -
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography. -
Clonality
Monoclonal -
Clone number
OTI4B4 -
Isotype
IgG1 -
Research areas
Images
-
Anti-UBE2E3 antibody [OTI4B4] (ab128098) at 1/200 dilution + HepG2 (Human liver hepatocellular carcinoma cell line) extracts at 10 µg
Predicted band size: 22 kDa
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UBE2E3 antibody [OTI4B4] (ab128098)Paraffin-embedded human endometrium adenocarcinoma tissue stained for UBE2E3 with ab128098 at a 1/150 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.
-
HepG2 (human liver hepatocellular carcinoma cell line) cells stained for UBE2E3 using ab128098 at a 1/100 dilution in ICC/IF.
-
Flow cytometry analysis of HeLa (Human epithelial cell line from cervix adenocarcinoma) cells, using anti-UBE2E3 antibody (ab128098) in Red at 1/100 dilution, compared to a nonspecific negative control antibody in Blue.
-
Flow cytometry analysis of Jurkat (Human T cell leukemia cell line from peripheral blood) cells, using anti-UBE2E3 antibody (ab128098) in Red at 1/100 dilution, compared to a nonspecific negative control antibody in Blue.
-
Flow cytometry analysis of HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with either UBE2E3 overexpressing plasmid (Red) or empty vector control plasmid (Blue) and immunostained by anti-UBE2E3 antibody (ab128098) at 1/100 dilution.
-
All lanes : Anti-UBE2E3 antibody [OTI4B4] (ab128098) at 1/2000 dilution
Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cells were transfected with pCMV6-ENTRY control cDNA
Lane 2 : HEK-293T cells were transfected with pCMV6-ENTRY UBE2E3 cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 22 kDa

