Anti-TTK/Mps1 antibody (ab24227)
Key features and details
- Rabbit polyclonal to TTK/Mps1
- Suitable for: ICC/IF, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TTK/Mps1 antibody
See all TTK/Mps1 primary antibodies -
Description
Rabbit polyclonal to TTK/Mps1 -
Host species
Rabbit -
Specificity
ab24227 reacts with TTK (MPS1) protein. We have data to indicate that this antibody may not cross react with Mouse. However, this has not been conclusively tested and expression levels may vary in certain cell lines/tissues. -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF HumanIP HumanWB Human -
Immunogen
Synthetic peptide corresponding to Human TTK/Mps1 aa 800-841 (C terminal).
Sequence:LVGLNSPNSILKAAKTLYEHYSGGESHNSSSSKTFEKKRGKK
-
Positive control
- Hela cell lysate.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituents: 0.021% PBS, 1.764% Sodium citrate, 1.815% Tris -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
Antibody was affinity purified using an epitope specific to TTK immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Detection of TTK/Mps1 by western blot of immunoprecipitates.
Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cells prepared using NETN lysis buffer.
Antibodies: ab24227 used for IP at 6 µg per reaction. For blotting immunoprecipitated TTTK/Mps1, ab24227 was used at 0.1 µg/mL.
Detection: Chemiluminescence with an exposure time of 3 minutes. -
All lanes : Anti-TTK/Mps1 antibody (ab24227)
Lane 1 : HeLa cell lyste at 15µg and ab at 0.033ug/ml
Lane 2 : HeLa cell lyste at 50ug and ab at 0.033ug/ml
Lanes 3-4 : HeLa cell lyste at 50ug and ab at 0.33ug/ml
Lanes 5-7 : HeLa cell lyste at 2mg and ab at 1ug/2mg lysate
Developed using the ECL technique.
Predicted band size: 95 kDa
Observed band size: 95 kDaECL exposure time:
A: 1min
B: 15 second
C: 30 second -
ICC/IF image of TTK/Mps1 stained Hek293 cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab24227, 5µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-rabbit IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

