Anti-Eros antibody (ab150936)
Key features and details
- Rabbit polyclonal to Eros
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Eros antibody -
Description
Rabbit polyclonal to Eros -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Eros aa 125-187.
Sequence:MVVLRLATGFSHPLTQSAVMGHRSDVEAIAKLITSFLELHCLESPTELSQ SSDSEAGDPASQS
-
Positive control
- IHC-P: Human tonsil. colon, prostate and placenta tissue. ICC: A431 whole cells.
-
General notes
This product was previously labelled as C17orf62.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemical analysis of human tonsil tissue labeling Eros in the cytoplasm of non-germinal center cells with ab150936 at a 1/500 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunocytochemical analysis of A431 (Human epidermoid carcinoma cell line) whole cells labeling Eros in the plasma membrane and cell junctions with ab150936 at 2 µg/ml.
-
Immunohistochemical analysis of human colon tissue labeling Eros in the cytoplasm of lymphoid cells with ab150936 at a 1/500 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemical analysis of human prostate tissue labeling Eros in the membrane of smooth muscle cells with ab150936 at a 1/500 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemical analysis of human placenta tissue labeling Eros in the cytoplasm of trophoblastic cells with ab150936 at a 1/500 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.