Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cell Biology Other Antibodies

Anti-Eros antibody (ab150936)

Anti-Eros antibody (ab150936)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to Eros
  • Suitable for: ICC/IF, IHC-P
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-TTC19 antibody [EPR13184-63] - BSA and Azide free (ab250415)
Product image
Human KRTCAP2 (KCP-2) knockout HEK-293T cell line (ab266719)
Product image
Anti-UMOD antibody - BSA and Azide free (Capture) (ab259581)
Product image
Anti-SAMD9 antibody [EPR13603] (ab180575)

Overview

  • Product name

    Anti-Eros antibody
  • Description

    Rabbit polyclonal to Eros
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Eros aa 125-187.
    Sequence:

    MVVLRLATGFSHPLTQSAVMGHRSDVEAIAKLITSFLELHCLESPTELSQ SSDSEAGDPASQS

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • IHC-P: Human tonsil. colon, prostate and placenta tissue. ICC: A431 whole cells.
  • General notes

    This product was previously labelled as C17orf62.

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cell Biology
    • Other Antibodies
    • Other Antibodies

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eros antibody (ab150936)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eros antibody (ab150936)

    Immunohistochemical analysis of human tonsil tissue labeling Eros in the cytoplasm of non-germinal center cells with ab150936 at a 1/500 dilution.

    Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

  • Immunocytochemistry/ Immunofluorescence - Anti-Eros antibody (ab150936)
    Immunocytochemistry/ Immunofluorescence - Anti-Eros antibody (ab150936)

    Immunocytochemical analysis of A431 (Human epidermoid carcinoma cell line) whole cells labeling Eros in the plasma membrane and cell junctions with ab150936  at 2 µg/ml.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eros antibody (ab150936)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eros antibody (ab150936)

    Immunohistochemical analysis of human colon tissue labeling Eros in the cytoplasm of lymphoid cells with ab150936 at a 1/500 dilution.

    Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eros antibody (ab150936)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eros antibody (ab150936)

    Immunohistochemical analysis of human prostate tissue labeling Eros in the membrane of smooth muscle cells with ab150936 at a 1/500 dilution.

    Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eros antibody (ab150936)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Eros antibody (ab150936)

    Immunohistochemical analysis of human placenta tissue labeling Eros in the cytoplasm of trophoblastic cells with ab150936 at a 1/500 dilution.

    Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Clear all

Recently viewed products

  •  
  • Product image

    Anti-PDHB antibody (ab154541)

  •  
  • Product image

    Anti-SIX2 antibody (ab220826)

  •  
  • Product image

    Anti-GM2A antibody (ab224246)

  •  
  • Product image

    Anti-FOXN3 antibody (ab129453)

  •  
  • Product image

    Recombinant human MYLK4 protein (ab190995)

  •  
  • Product image

    Human Testosterone free ELISA Kit (ab178663)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.