Anti-TOMM22/TOM22 antibody (ab57523)
Key features and details
- Mouse monoclonal to TOMM22/TOM22
- Suitable for: WB, IHC-P, Flow Cyt, ICC/IF
- Reacts with: Mouse, Human
- Isotype: IgG2a
Overview
-
Product name
Anti-TOMM22/TOM22 antibody
See all TOMM22/TOM22 primary antibodies -
Description
Mouse monoclonal to TOMM22/TOM22 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanICC/IF HumanIHC-P HumanWB Mouse
-
Immunogen
Recombinant full length protein (GST-tag) corresponding to Human TOMM22/TOM22 aa 1-142.
Sequence:MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWG LTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVV FETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI
Database link: Q9NS69 -
Positive control
- IHC-P: Human small Intestine. ICC/IF: HeLa cell. WB: NIH/3T3 cell lysate. Flow cyt: HeLa cells.
-
General notes
Previously labelled as TOMM22.
This product was changed from ascites to tissue culture supernatant on 15 May 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.4 -
Concentration information loading... -
Purity
Tissue culture supernatant -
Purification notes
Purified from TCS. -
Clonality
Monoclonal -
Isotype
IgG2a -
Light chain type
kappa -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TOMM22/TOM22 antibody (ab57523)
TOMM22/TOM22 antibody (ab57523) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human small Intestine.
This image was generated using the ascites version of the product.
-
Western blot - Anti-TOMM22/TOM22 antibody (ab57523)TOMM22/TOM22 antibody (ab57523) at 1ug/lane + NIH/3T3 cell lysate at 25ug/lane.
This image was generated using the ascites version of the product.
-
Western blot - Anti-TOMM22/TOM22 antibody (ab57523)Anti-TOMM22/TOM22 antibody (ab57523) + immunogen peptide, Full length TOMM22 / TOM22 with GST tag.
Predicted band size: 15 kDaGST tag MW is 26kDa.
-
Immunocytochemistry/ Immunofluorescence - Anti-TOMM22/TOM22 antibody (ab57523)Immunocytochemistry/ Immunofluorescence of TOMM22 in HeLa cell using ab57523 at 10 μg/ml.
-
Immunocytochemistry/ Immunofluorescence - Anti-TOMM22/TOM22 antibody (ab57523)ICC/IF image of ab57523 stained HeLa cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab57523, 10µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.
This image was generated using the ascites version of the product.
-
Flow Cytometry - Anti-TOMM22/TOM22 antibody (ab57523)Overlay histogram showing HeLa cells stained with ab57523 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab57523, 1µg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 1µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed.
This image was generated using the ascites version of the product.