Anti-Thyroxine Binding Globulin antibody [1C3H11] (ab181778)
Key features and details
- Mouse monoclonal [1C3H11] to Thyroxine Binding Globulin
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-Thyroxine Binding Globulin antibody [1C3H11]
See all Thyroxine Binding Globulin primary antibodies -
Description
Mouse monoclonal [1C3H11] to Thyroxine Binding Globulin -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Sheep, Cow, Pig, Chimpanzee
-
Immunogen
Recombinant fragment corresponding to Human Thyroxine Binding Globulin aa 168-302. Expressed in E. Coli.
Sequence:AAKQEINSHVEMQTKGKVVGLIQDLKPNTIMVLVNYIHFKAQWANPFDPS KTEDSSSFLIDKTTTVQVPMMHQMEQYYHLVDMELNCTVLQMDYSKNALA LFVLPKEGQMESVEAAMSSKTLKKWNRLLQKGWVD
Database link: P05543 -
Positive control
- Human Thyroxine Binding Globulin recombinant protein; HEK293 cell lysate, transfected with Thyroxine Binding Globulin (amino acids 168-302)-IgGFc.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS
0.5% protein stabilizer -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
1C3H11 -
Isotype
IgG1 -
Research areas
Images
-
Anti-Thyroxine Binding Globulin antibody [1C3H11] (ab181778) at 1/500 dilution + Human Thyroxine Binding Globulin recombinant protein
Predicted band size: 46 kDa
-
All lanes : Anti-Thyroxine Binding Globulin antibody [1C3H11] (ab181778) at 1/500 dilution
Lane 1 : HEK293 cell lysate, non-transfected
Lane 2 : HEK293 cell lysate, transfected with Thyroxine Binding Globulin (amino acids 168-302)-hIgGFc
Predicted band size: 46 kDa

