Anti-TCP1 theta antibody (ab176691)
Key features and details
- Rabbit polyclonal to TCP1 theta
- Suitable for: WB, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-TCP1 theta antibody
See all TCP1 theta primary antibodies -
Description
Rabbit polyclonal to TCP1 theta -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human
-
Immunogen
Synthetic peptide within Human TCP1 theta aa 498-548. The exact sequence is proprietary.
Sequence:LDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKKDWDDDQN D
Database link: P50990 -
Positive control
- HeLa, 293T, Jurkat or Mouse NIH3T3 lysate.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 0.1% BSA, 99% Tris buffered saline
pH: 7 to 8 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunoprecipitation - Anti-TCP1 theta antibody (ab176691)
Detection of Human TCP1 theta by Western Blot of Immunoprecipitates. 1 mg for IP; 20% of IP HeLa whole cell lysate loaded. ab176691 used for IP at 6 µg/mg lysate. For blotting immunoprecipitated TCP1 theta, ab176691 was used at 0.04 µg/ml.
-
Western blot - Anti-TCP1 theta antibody (ab176691)All lanes : Anti-TCP1 theta antibody (ab176691) at 0.04 µg/ml
Lane 1 : HeLa lysate at 50 µg
Lane 2 : HeLa lysate at 15 µg
Lane 3 : 293T lysate at 50 µg
Lane 4 : Jurkat lysate at 50 µg
Lane 5 : Mouse NIH3T3 lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 60 kDa
Exposure time: 10 seconds
