Anti-SRY/TDF antibody [OTI3C8] (ab140309)
Key features and details
- Mouse monoclonal [OTI3C8] to SRY/TDF
- Suitable for: WB, ICC/IF
- Reacts with: Human, African green monkey
- Isotype: IgG1
Overview
-
Product name
Anti-SRY/TDF antibody [OTI3C8]
See all SRY/TDF primary antibodies -
Description
Mouse monoclonal [OTI3C8] to SRY/TDF -
Host species
Mouse -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human, African green monkey
Predicted to work with: Chimpanzee, Macaque monkey, Gorilla, Orangutan -
Immunogen
Recombinant full length protein corresponding to Human SRY/TDF aa 1-204.
Sequence:MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGE NSKGNVQDRVKRPMNAFIVW SRDQRRKMALENPRMRNSEISKQLGYQW KMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPK NCSLLP ADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRD RYSHWTKL
Database link: NP_003131 -
Positive control
- Purchase matching WB positive control:Recombinant Human SRY/TDF protein
- WB: HEK293T cells transfected with pCMV6-ENTRY SRY/TDF cDNA; ICC/IF: COS7 cells transiently transfected by pCMV6-ENTRY SRY/TDF.
-
General notes
The clone number has been updated from 3C8 to OTI3C8, both clone numbers name the same clone.
This product was previously labelled as SRY
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 1% BSA, PBS -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography -
Clonality
Monoclonal -
Clone number
OTI3C8 -
Isotype
IgG1 -
Research areas
Images
-
Immunofluorescent staining of COS7 cells transiently transfected by pCMV6-ENTRY SRY/TDF, labelling SRY/TDF with ab140309 at 1/100 dilution.
-
All lanes : Anti-SRY/TDF antibody [OTI3C8] (ab140309) at 1/2000 dilution
Lane 1 : HEK293T cell lysate transfected with pCMV6-ENTRY control cDNA.
Lane 2 : HEK293T cell lysate transfected with pCMV6-ENTRY SRY/TDF cDNA.
Lysates/proteins at 5 µg per lane.
Predicted band size: 24 kDa