Anti-SNRNP200 antibody (ab176715)
Key features and details
- Rabbit polyclonal to SNRNP200
- Suitable for: WB, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-SNRNP200 antibody
See all SNRNP200 primary antibodies -
Description
Rabbit polyclonal to SNRNP200 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human -
Immunogen
Synthetic peptide within Human SNRNP200 aa 400-450. The exact sequence is proprietary. NP_054733.2
Sequence:GEALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPA L
Database link: O75643 -
Positive control
- HeLa, 293T, Jurkat and NIH3T3 whole cell lysates.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7.0-8.0 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab176715 was affinity purified using an epitope specific to SNRNP200 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
SNRNP200 was immunoprecipitated from 1mg HeLa whole cell lysate using ab176715 at 6 μg/mg lysate (Lane 2), a rabbit anti-SNRNP200 antibody recognizing an upstream epitope (Lane 1) or control IgG (Lane 3). 20% of the Immunoprecipitate was loaded per lane and then immunobotted using ab176715 at 1.0 μg/ml.
Detection:
Chemiluminescence with exposure time of 10 seconds.
-
All lanes : Anti-SNRNP200 antibody (ab176715) at 0.1 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : 293T whole cell lysate at 50 µg
Lane 4 : Jurkat whole cell lysate at 50 µg
Lane 5 : NIH3T3 whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 245 kDa
Exposure time: 30 seconds

