Anti-SMC5 antibody (ab18038)
Key features and details
- Rabbit polyclonal to SMC5
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SMC5 antibody
See all SMC5 primary antibodies -
Description
Rabbit polyclonal to SMC5 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species WB Human -
Immunogen
Synthetic peptide:
FFITPKLLQNLPYSEKMTVLFVYNGPHMLEP
, corresponding to C terminal amino acids 1050-1101 of Human SMC5, using the numbering given in TrEMBL entry Q8IY18 (GeneID 23137).
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7
Preservative: 0.1% Sodium azide
Constituents: 0.021% PBS, 1.764% Sodium citrate, 1.815% Tris -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
Antibody was purified using an epitope specific to SMC5 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Ab18038 staining Human SMC5 at a concentration of 0.1
g/ml by Western Blot, and 5µ g/0.5 mg lysate by Immunoprecipitation.µ Samples:
A) Nuclear extract (10 and 20
g) from HeLa cells.µ B) Whole cell lysate (500
g) from HeLa and 293T cells.µ Detection: Chemiluminescence with exposure times of less than 2 minutes.
Ab18038 staining Human SMC5 at a concentration of 0.1 µg/ml by Western Blot, and 5 µg/0.5 mg lysate by Immunoprecipitation.Samples:
A) Nuclear extract (10 and 20 µg) from HeLa cells.
B) Whole cell lysate (500 µg) from HeLa and 293T cells.
Detection: Chemiluminescence with exposure times of less than 2 minutes.

