Anti-smAKAP antibody (ab151068)
Key features and details
- Rabbit polyclonal to smAKAP
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-smAKAP antibody -
Description
Rabbit polyclonal to smAKAP -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IHC-P Human
-
Immunogen
Recombinant fragment corresponding to Human smAKAP aa 1-73.
Sequence:MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKE PPGTNTVILEYAHRLSQDILCDA
-
Positive control
- IHC-P: Human small intestine, kidney tissue.
-
General notes
The antibody solution should be gently mixed before use.Previously labelled as C2orf88.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-smAKAP antibody (ab151068)
Paraffin embedded human small intestine tissue stained for smAKAP using ab151068 at 1/1000 dilution in immunohistochemical analysis.
Heat mediated antigen retrieval was performed with citrate buffer pH 6 before IHC staining protocol was commenced.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-smAKAP antibody (ab151068)Paraffin embedded human pancreas tissue stained for smAKAP using ab151068 at 1/1000 dilution in immunohistochemical analysis.
Heat mediated antigen retrieval was performed with citrate buffer pH 6 before IHC staining protocol was commenced.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-smAKAP antibody (ab151068)Paraffin embedded human endometrium tissue stained for smAKAP using ab151068 at 1/1000 dilution in immunohistochemical analysis.
Heat mediated antigen retrieval was performed with citrate buffer pH 6 before IHC staining protocol was commenced.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-smAKAP antibody (ab151068)Paraffin embedded human cerebellum tissue stained for smAKAP using ab151068 at 1/1000 dilution in immunohistochemical analysis. Shows no positivity in Purkinje cells as expected.
Heat mediated antigen retrieval was performed with citrate buffer pH 6 before IHC staining protocol was commenced.