Anti-Sly1 antibody (ab86594)
Key features and details
- Rabbit polyclonal to Sly1
- Suitable for: WB, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-Sly1 antibody
See all Sly1 primary antibodies -
Description
Rabbit polyclonal to Sly1 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human
-
Immunogen
Synthetic peptide corresponding to Human Sly1 aa 300-350 (internal sequence).
Sequence:VENSPAGARPKRKNKKSYDLTPVDKFWQKHKGSPFPEVAESVQQELESYR A
Database link: NP_057190.2 -
Positive control
- Whole cell lysate from HeLa cells, 293T cells or NIH3T3 cells.
-
General notes
Previously labelled as SCFD1.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 0.1% BSA, Tris buffered saline -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Western blot - Anti-Sly1 antibody (ab86594)All lanes : Anti-Sly1 antibody (ab86594) at 0.04 µg/ml
Lane 1 : Whole cell lysate from HeLa cells at 50 µg
Lane 2 : Whole cell lysate from HeLa cells at 15 µg
Lane 3 : Whole cell lysate from HeLa cells at 5 µg
Lane 4 : Whole cell lysate from 293T cells at 50 µg
Lane 5 : Whole cell lysate from NIH3T3 cells at 50 µg
Predicted band size: 72 kDa
Exposure time: 3 minutes
-
Immunoprecipitation - Anti-Sly1 antibody (ab86594)1mg whole cell lysate from Hela cells was immunoprecipited using 3ug ab86594. 20% of IP was loaded per lane, and probed with ab86549 at 1ug/ml (lane 1) or with a control IgG (lane 2).
Detection: chemiluminescence with an exposure time of 30 seconds.
