Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Epigenetics and Nuclear Signaling DNA / RNA RNA Processing Splicing

Anti-SF3A3 antibody (ab176581)

Price and availability

261 331 ₸

Availability

Order now and get it on Wednesday February 24, 2021

Anti-SF3A3 antibody (ab176581)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to SF3A3
  • Suitable for: WB, IP, IHC-P
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-TRA2B/SFRS10 antibody (ab31353)
Product image
Anti-SNRPF antibody [EPR10389(B)] - BSA and Azide free (ab249275)
Product image
Anti-YTHDC1 antibody [EPR21821] (ab220159)
Product image
Anti-nmt55 / p54nrb antibody - N-terminal (ab227014)

Overview

  • Product name

    Anti-SF3A3 antibody
    See all SF3A3 primary antibodies
  • Description

    Rabbit polyclonal to SF3A3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Cow, Dog, Pig, Xenopus laevis, Zebrafish, Rhesus monkey
  • Immunogen

    Synthetic peptide within Human SF3A3 aa 451-501 (C terminal). The exact sequence is proprietary. (NP_006793.1)
    Sequence:

    QIEDAVSLWAKLKLQKASERWQPDTEEEYEDSSGNVVNKKTYEDLKRQGL L


    Database link: Q12874
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 6.8
    Preservative: 0.09% Sodium azide
    Constituents: 99% Tris buffered saline, 0.1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab176581 was affinity purified using an epitope specific to SF3A3 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Epigenetics and Nuclear Signaling
    • DNA / RNA
    • RNA Processing
    • Splicing

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SF3A3 antibody (ab176581)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SF3A3 antibody (ab176581)

    Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human colon carcinoma tissue labeling SF3A3 with ab176581 at 1µg/ml.

  • Western blot - Anti-SF3A3 antibody (ab176581)
    Western blot - Anti-SF3A3 antibody (ab176581)
    All lanes : Anti-SF3A3 antibody (ab176581) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 5 µg
    Lane 4 : 293T whole cell lysate at 50 µg
    Lane 5 : NIH3T3 whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 59 kDa


    Exposure time: 30 seconds
  • Immunoprecipitation - Anti-SF3A3 antibody (ab176581)
    Immunoprecipitation - Anti-SF3A3 antibody (ab176581)

    Detection of SF3A3 in Immunoprecipitates of HeLa whole cell lysates (1 mg for IP, 20% of IP loaded) using ab176581 at 3 µg/mg lysate for IP (Lane 1). For WB detection ab176581 was used at 0.4 µg/ml. Lane 2 represents control IgG IP. Detection: Chemiluminescence with an exposure time of 10 seconds.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-SF3A3 antibody (ab176581)

  •  
  • Product image

    Anti-SF3A3 antibody (ab224814)

    Applications: IP, WB

  •  
  • Product image

    Anti-SF3A3 antibody [EPR10020] (ab156873)

    Applications: ICC/IF, IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Human alpha-2 antiplasmin ELISA Kit (ab254502)

  •  
  • Product image

    Anti-RPS8 antibody (ab230651)

  •  
  • Product image

    Anti-ME1 antibody (ab223761)

  •  
  • Product image

    Anti-LNK antibody (ab244278)

  •  
  • Anti-BRCA1 antibody [GLK-2] (ab17251)

  •  
  • Product image

    Anti-P97/DAP5 antibody (ab117804)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.