Anti-SerpinB3/SCCA antibody [OTI1A5] (ab180396)
Key features and details
- Mouse monoclonal [OTI1A5] to SerpinB3/SCCA
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-SerpinB3/SCCA antibody [OTI1A5]
See all SerpinB3/SCCA primary antibodies -
Description
Mouse monoclonal [OTI1A5] to SerpinB3/SCCA -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human SerpinB3/SCCA aa 1-390. Produced in HEK-293T cell (NP_008850).
Sequence:MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTA QQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYE LKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSW VESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKF WPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNE IDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLR TMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVV GFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
Database link: P29508 -
Positive control
- IHC-P: Human kidney, lung carcinoma, pancreas and bladder carcinoma tissues. WB: HEK-293T cell lysate transfected with pCMV6-ENTRY SerpinB3/SCCA cDNA.
-
General notes
Clone OTI1A5 (formerly 1A5).
Protein previously labeled as SerpinB3.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, PBS, 1% BSA -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography. -
Clonality
Monoclonal -
Clone number
OTI1A5 -
Isotype
IgG1 -
Research areas
Images
-
All lanes : Anti-SerpinB3/SCCA antibody [OTI1A5] (ab180396) at 1/2000 dilution
Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY SerpinB3/SCCA cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 45 kDa
-
Paraffin-embedded human kidney tissue stained for SerpinB3/SCCA using ab180396 at 1/150 dilution in immunohistochemical analysis.
-
Paraffin-embedded human lung carcinoma tissue stained for SerpinB3/SCCA using ab180396 at 1/150 dilution in immunohistochemical analysis.
-
Paraffin-embedded human pancreas tissue stained for SerpinB3/SCCA using ab180396 at 1/150 dilution in immunohistochemical analysis.
-
Paraffin-embedded human bladder carcinoma tissue stained for SerpinB3/SCCA using ab180396 at 1/150 dilution in immunohistochemical analysis.