Anti-Sall4 antibody (ab57577)
Key features and details
- Mouse monoclonal to Sall4
- Suitable for: WB, IHC-P, Flow Cyt
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-Sall4 antibody
See all Sall4 primary antibodies -
Description
Mouse monoclonal to Sall4 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanIHC-P HumanWB Human -
Immunogen
Recombinant fragment corresponding to Human Sall4 aa 954-1054.
Sequence:PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLG ATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS
Database link: Q9UJQ4 -
Positive control
- WB: HeLa cell lysate, IHC-P: human testis. Flow Cyt: HeLa cells.
-
General notes
This product was changed from ascites to tissue culture supernatant on 12th Feb 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.4 -
Concentration information loading...
-
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody (ab57577) Image from Gassei, Kathrin, et. al. PLoS ONE 8.1 (2013): e53976. doi: 10.1371/journal.pone.0053976. Fig 2A,D. Reproduced under the Creative Commons license http://creativecommons.org/licenses/by/4.0/
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of testes from juvenile (PND 7 and PND 14) mice labeling Sall4 with ab57577. Testes were dissected and fixed in 4% PFA overnight at 4°C. Fixed tissues were processed for paraffin embedding and 5 µm serial sections were collected. Sections were deparaffinized in xylene (2×15 min), rehydrated in a graded ethanol series (2×100% for 10 min, 1×95% for 5 min, 1×80% for 5 min, 1×70% for 5 min, 1×50% for 5 min, 1×25% for 5 min) and rinsed in 1× DPBS. Slides were then incubated in sodium citrate antigen retrieval buffer (10 mM Sodium Citrate, 0.05% Tween-20, pH 6) for 30 min at 97.5°C and allowed to cool to room temperature. After rinsing twice in 1× DPBS containing 0.1% Tween-20 (DBPS-T), unspecific binding sites in tissue sections were saturated by incubation with blocking buffer (1× DPBS containing 3% bovine serum albumin, 0.1% Triton X-100 and 5% normal serum from the host species of the secondary antibody) for 30 min at room temperature. Primary antibodies were diluted in blocking buffer and added to tissue sections for 90 min at room temperature.
This image was generated using the ascites version of the product.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody (ab57577) This image is courtesy of an Abreview from Zachary Yu-Ching Lin.
IHC-P image of Sall4 staining with ab57577 on tissue sections from adult mouse testis. The sections were subjected to heat-mediated antigen retrieval using Dako antigen retrieval solution. The sections were then blocked with 5% milk for 30 minutes at 25°C, before incubation with ab57577 (1/100 dilution) for 18 hours at 4°C. The secondary was an Alexa-Fluor 488 conjugated goat anti-mouse polyclonal, used at a 1/500 dilution.
This image was generated using the ascites version of the product.
-
Sall4 antibody (ab57577) at 1ug/lane + HeLa cell lysate at 25ug/lane.
This image was generated using the ascites version of the product.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody (ab57577)
Sall4 antibody (ab57577) used in immunohistochemistry at 5ug/ml on formalin fixed and paraffin embedded human testis.
This image was generated using the ascites version of the product.
-
Overlay histogram showing HeLa cells stained with ab57577 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab57577, 1µg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HeLa cells fixed with 4% paraformaldehyde/permeabilized in 0.1% PBS-Tween used under the same conditions.
This image was generated using the ascites version of the product.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody (ab57577) This image is courtesy of an Abreview from Zachary Yu-Ching Lin.
IHC-P image of Sall4 staining with ab57577 on tissue sections from adult marmoset testis. The sections were subjected to heat-mediated antigen retrieval using Dako antigen retrieval solution. The sections were then blocked with 5% milk for 30 minutes at 25°C, before incubation with ab57577 (1/100 dilution) for 18 hours at 4°C. The secondary was an Alexa-Fluor 488 conjugated goat anti-mouse polyclonal, used at a 1/500 dilution.
This image was generated using the ascites version of the product.