Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Epigenetics and Nuclear Signaling Transcription Domain Families Zinc Finger

Anti-Sall4 antibody (ab57577)

Price and availability

381 945 ₸

Availability

Order now and get it on Thursday March 04, 2021

Anti-Sall4 antibody (ab57577)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal to Sall4
  • Suitable for: WB, IHC-P, Flow Cyt
  • Reacts with: Human
  • Isotype: IgG1

You may also be interested in

Product image
Anti-RXRG antibody (ab53162)
Product image
Recombinant Human Vitamin D Receptor protein (ab82068)
Mifepristone (RU486), Progesterone and Glucocorticoid receptor antagonist (ab120356)
Product image
Anti-ZFY antibody (ab221906)

Overview

  • Product name

    Anti-Sall4 antibody
    See all Sall4 primary antibodies
  • Description

    Mouse monoclonal to Sall4
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    Flow Cyt
    Human
    IHC-P
    Human
    WB
    Human
    See all applications and species data
  • Immunogen

    Recombinant fragment corresponding to Human Sall4 aa 954-1054.
    Sequence:

    PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLG ATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS


    Database link: Q9UJQ4
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HeLa cell lysate, IHC-P: human testis. Flow Cyt: HeLa cells.
  • General notes

    This product was changed from ascites to tissue culture supernatant on 12th Feb 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.4
  • Concentration information loading...
  • Purity

    Tissue culture supernatant
  • Clonality

    Monoclonal
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

    • Epigenetics and Nuclear Signaling
    • Transcription
    • Domain Families
    • Zinc Finger
    • Stem Cells
    • Embryonic Stem Cells
    • Intracellular
    • Stem Cells
    • Signaling Pathways
    • Wnt
    • Nuclear
    • Developmental Biology
    • Embryogenesis
    • Embryonic stem cells
    • Surface molecules

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody (ab57577)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody (ab57577) Image from Gassei, Kathrin, et. al. PLoS ONE 8.1 (2013): e53976. doi: 10.1371/journal.pone.0053976. Fig 2A,D. Reproduced under the Creative Commons license http://creativecommons.org/licenses/by/4.0/

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of testes from juvenile (PND 7 and PND 14) mice labeling Sall4 with ab57577. Testes were dissected and fixed in 4% PFA overnight at 4°C. Fixed tissues were processed for paraffin embedding and 5 µm serial sections were collected. Sections were deparaffinized in xylene (2×15 min), rehydrated in a graded ethanol series (2×100% for 10 min, 1×95% for 5 min, 1×80% for 5 min, 1×70% for 5 min, 1×50% for 5 min, 1×25% for 5 min) and rinsed in 1× DPBS. Slides were then incubated in sodium citrate antigen retrieval buffer (10 mM Sodium Citrate, 0.05% Tween-20, pH 6) for 30 min at 97.5°C and allowed to cool to room temperature. After rinsing twice in 1× DPBS containing 0.1% Tween-20 (DBPS-T), unspecific binding sites in tissue sections were saturated by incubation with blocking buffer (1× DPBS containing 3% bovine serum albumin, 0.1% Triton X-100 and 5% normal serum from the host species of the secondary antibody) for 30 min at room temperature. Primary antibodies were diluted in blocking buffer and added to tissue sections for 90 min at room temperature.

    This image was generated using the ascites version of the product.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody (ab57577)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody (ab57577) This image is courtesy of an Abreview from Zachary Yu-Ching Lin.

    IHC-P image of Sall4 staining with ab57577 on tissue sections from adult mouse testis. The sections were subjected to heat-mediated antigen retrieval using Dako antigen retrieval solution. The sections were then blocked with 5% milk for 30 minutes at 25°C, before incubation with ab57577 (1/100 dilution) for 18 hours at 4°C. The secondary was an Alexa-Fluor 488 conjugated goat anti-mouse polyclonal, used at a 1/500 dilution.

    This image was generated using the ascites version of the product.

    See Abreview

  • Western blot - Anti-Sall4 antibody (ab57577)
    Western blot - Anti-Sall4 antibody (ab57577)

    Sall4 antibody (ab57577) at 1ug/lane + HeLa cell lysate at 25ug/lane.

    This image was generated using the ascites version of the product.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody (ab57577)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody (ab57577)

    Sall4 antibody (ab57577) used in immunohistochemistry at 5ug/ml on formalin fixed and paraffin embedded human testis.

    This image was generated using the ascites version of the product.

  • Flow Cytometry - Anti-Sall4 antibody (ab57577)
    Flow Cytometry - Anti-Sall4 antibody (ab57577)

    Overlay histogram showing HeLa cells stained with ab57577 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab57577, 1µg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HeLa cells fixed with 4% paraformaldehyde/permeabilized in 0.1% PBS-Tween used under the same conditions.

    This image was generated using the ascites version of the product.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody (ab57577)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sall4 antibody (ab57577) This image is courtesy of an Abreview from Zachary Yu-Ching Lin.

    IHC-P image of Sall4 staining with ab57577 on tissue sections from adult marmoset testis. The sections were subjected to heat-mediated antigen retrieval using Dako antigen retrieval solution. The sections were then blocked with 5% milk for 30 minutes at 25°C, before incubation with ab57577 (1/100 dilution) for 18 hours at 4°C. The secondary was an Alexa-Fluor 488 conjugated goat anti-mouse polyclonal, used at a 1/500 dilution.

    This image was generated using the ascites version of the product.

    See Abreview

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Sall4 antibody (ab57577)

  •  
  • Product image

    Anti-Sall4 antibody [EPR10642] (ab181087)

    Applications: IHC-P

  •  
  • Product image

    Anti-Sall4 antibody [SP289] (ab226756)

    Applications: Flow Cyt, ICC/IF, IHC-P

  •  
  • Product image

    Anti-Sall4 antibody (ab29112)

    Applications: ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-Sall4 antibody [SP289] - BSA and Azide free (ab245759)

    Applications: Flow Cyt, ICC/IF, IHC-P

Clear all

Recently viewed products

  •  
  • Product image

    Anti-CNOT3 antibody (ab154276)

  •  
  • Product image

    Anti-LMO2 antibody [4D8] (ab140657)

  •  
  • Product image

    Anti-LIMK2 antibody (ab97766)

  •  
  • Product image

    Anti-BCG1 antibody (ab224485)

  •  
  • Product image

    Anti-CD11d antibody (ab231534)

  •  
  • Product image

    Anti-SARI antibody (ab204510)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.