Anti-RST antibody (ab121826)
Key features and details
- Rabbit polyclonal to RST
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-RST antibody
See all RST primary antibodies -
Description
Rabbit polyclonal to RST -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species ICC HumanIHC-P Human -
Immunogen
Recombinant fragment corresponding to Human RST aa 281-352.
Sequence:ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSM GQPPASLGTLLRMPGLRFRTCI
Database link: Q96S37 -
Positive control
- IHC-P: Human kidney tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling RST with ab121826 at 1/500 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lymph node tissue labelling RST with ab121826 at 1/500 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human testis tissue labelling RST with ab121826 at 1/500 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human liver tissue labelling RST with ab121826 at 1/500 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.

