Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Epigenetics and Nuclear Signaling DNA / RNA Translation Ribosome

Anti-Ribosomal protein S11/RPS11 antibody (ab157101)

Anti-Ribosomal protein S11/RPS11 antibody (ab157101)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to Ribosomal protein S11/RPS11
  • Suitable for: WB, IP
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Product image
Human DCAF13 knockout HeLa cell lysate (ab257914)
Product image
Anti-MRPL39 antibody - C-terminal (ab230655)
Product image
Recombinant Human RPL32P3 protein (ab165362)
Product image
Recombinant Human RPLP2 protein (ab123191)

Overview

  • Product name

    Anti-Ribosomal protein S11/RPS11 antibody
    See all Ribosomal protein S11/RPS11 primary antibodies
  • Description

    Rabbit polyclonal to Ribosomal protein S11/RPS11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Pig, Xenopus laevis, Chimpanzee, Rhesus monkey, Gorilla, Common marmoset, Orangutan, Xenopus tropicalis, Platypus
  • Immunogen

    Synthetic peptide corresponding to Human Ribosomal protein S11/RPS11 aa 1-50.
    Sequence:

    MADIQTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEA


    Database link: NP_001006.1
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • 293T, HeLa, Jurkat and NIH 3T3 whole cell lysates.
  • General notes

     This product was previously labelled as Ribosomal protein S11

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C.
  • Storage buffer

    pH: 7
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab157101 was affinity purified using an epitope specific to Ribosomal protein S11/RPS11 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Epigenetics and Nuclear Signaling
    • DNA / RNA
    • Translation
    • Ribosome

Images

  • Western blot - Anti-Ribosomal protein S11/RPS11 antibody (ab157101)
    Western blot - Anti-Ribosomal protein S11/RPS11 antibody (ab157101)
    All lanes : Anti-Ribosomal protein S11/RPS11 antibody (ab157101) at 0.1 µg/ml

    Lane 1 : 293T whole cell lysate at 50 µg
    Lane 2 : 293T whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 50 µg
    Lane 4 : Jurkat whole cell lysate at 50 µg
    Lane 5 : NIH 3T3 whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 18 kDa


    Exposure time: 10 seconds
  • Immunoprecipitation - Anti-Ribosomal protein S11/RPS11 antibody (ab157101)
    Immunoprecipitation - Anti-Ribosomal protein S11/RPS11 antibody (ab157101)

    Detection of Ribosomal protein S11/RPS11 in Immunoprecipitates of 293T whole cell lysates (1 mg for IP, 20% of IP loaded) using ab157101 at 6 µg/mg lysate for IP (Lane 1). For WB detection an ab157101 was used at 0.4 µg/ml. Lane 2 represents control IgG IP. Detection: Chemiluminescence with an exposure time of 10 seconds.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Ribosomal protein S11/RPS11 antibody (ab157101)

  •  
  • Product image

    Anti-Ribosomal protein S11/RPS11 antibody [EPR11487] (ab175213)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-Ribosomal protein S11/RPS11 antibody (ab193197)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-Ribosomal protein S11/RPS11 antibody [EPR11487] - BSA and Azide free (ab240183)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-PI 3 Kinase p85 alpha antibody [EP380Y] (ab40755)

  •  
  • Product image

    Anti-Proteasome Activator Subunit 4/PSME4 antibody [EPR13577(B)] - C-terminal (ab181203)

  •  
  • Product image

    Anti-E Cadherin antibody [CDH1] - BSA and Azide free (ab237953)

  •  
  • Product image

    Alexa Fluor® 647 Anti-PER2 antibody [EPR11381(2)] (ab210652)

  •  
  • Rabbit Anti-Goat IgG Fc (FITC) preadsorbed (ab102344)

  •  
  • Product image

    Anti-EGF antibody - BSA and Azide free (Detector) (ab245081)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.