Anti-Rho A + B + C antibody [1A11-4G10] (ab175328)
Key features and details
- Mouse monoclonal [1A11-4G10] to Rho A + B + C
- Suitable for: WB, IP, ICC/IF
- Reacts with: Mouse, Human
- Isotype: IgG1
Overview
-
Product name
Anti-Rho A + B + C antibody [1A11-4G10]
See all Rho A + B + C primary antibodies -
Description
Mouse monoclonal [1A11-4G10] to Rho A + B + C -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF MouseIP HumanWB Human -
Immunogen
Recombinant full length protein corresponding to Human Rho A + B + C aa 1-193.
Sequence:MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDG KQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWT PEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANR IGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Database link: P61586 -
Positive control
- HeLa, A431, HEK293T, U2OS and mouse NIH 3T3 cell lysates; mouse NIH 3T3 cells.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituents: 0.1% BSA, 30% Glycerol (glycerin, glycerine), 69% PBS -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Monoclonal -
Clone number
1A11-4G10 -
Isotype
IgG1 -
Research areas
Images
-
All lanes : Anti-Rho A + B + C antibody [1A11-4G10] (ab175328) at 1/1000 dilution
Lane 1 : HeLa cell lysate at 25 µg
Lane 2 : A431 cell lysate at 25 µg
Lane 3 : HEK293T cell lysate at 25 µg
Lane 4 : U2OS cell lysate at 25 µg
Lane 5 : Mouse NIH 3T3 cell lysate at 25 µg
Lane 6 : Purified full length His-tagged Rho A at 0.5 µg
Lane 7 : Purified truncated Rho B at 0.5 µg
Lane 8 : Purified full length Rho C at 0.5 µg
Secondary
All lanes : Goat anti-mouse IgG-HRP at 1/15000 dilution
Developed using the ECL technique.
-
Immunofluorescence analysis of formalin-fixed permeabilized mouse NIH 3T3 cells, labeling Rho A + B + C (green, left panel) using ab175328 at a 1/100 dilution followed by DyLight 488-conjugated goat anti-mouse IgG secondary antibody at a 1/400 dilution. Nuclei (blue) were stained with Hoechst 33342 dye (central panel).
-
Western blot analysis on immunoprecipitation pellet from HeLa cells. The antigen-antibody complex was formed by incubating 750 µg of HeLa cell lysate with 2 µg of ab175328 overnight at 4°C. The immune-complex was then captured on 50 µl of Protein A/G Plus Agarose, washed extensively and eluted in sample buffer. 1) 25 µg of HeLa cell lysate and 2) eluted sample were resolved on a SDS PAGE gel. The membrane was probed with ab175328 at a 1/1000 dilution. An anti-mouse IgG-HRP secondary antibody at a 1/2500 dilution was used. Chemiluminescent detection was perfomed.

