Anti-Retinoic Acid Receptor alpha antibody [H1920] (ab41934)
Key features and details
- Mouse monoclonal [H1920] to Retinoic Acid Receptor alpha
- Suitable for: Flow Cyt
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-Retinoic Acid Receptor alpha antibody [H1920]
See all Retinoic Acid Receptor alpha primary antibodies -
Description
Mouse monoclonal [H1920] to Retinoic Acid Receptor alpha -
Host species
Mouse -
Tested applications
Suitable for: Flow Cytmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Dog
-
Immunogen
Recombinant fragment:
MASNSSSCPTPGGGHLNGYPVPPYAFFFPP
, corresponding to amino acids 1-30 of Human Retinoic Acid Receptor alpha -
General notes
This product was changed from ascites to tissue culture supernatant on 3rd April 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.1% Sodium azide
Physiological saline. -
Concentration information loading... -
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Clone number
H1920 -
Isotype
IgG1 -
Research areas
Images
-
Overlay histogram showing MCF7 cells stained with ab41934 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab41934, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells ) used under the same conditions. Acquisition of >5,000 events was performed.
This image was generated using the ascites version of the product.

