Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cell Biology Proteolysis / Ubiquitin Proteasome / Ubiquitin Proteasome

Anti-PSMF1 antibody (ab140497)

Anti-PSMF1 antibody (ab140497)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to PSMF1
  • Suitable for: WB, IP
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-Proteasome 20S alpha 5/PSMA5 antibody (ab189855)
Product image
Anti-CSN7A antibody (ab192381)
Product image
Alexa Fluor® 647 Anti-UCH37 antibody [EP4897] (ab225166)
Product image
Anti-PAC1 antibody (ab99000)

Overview

  • Product name

    Anti-PSMF1 antibody
    See all PSMF1 primary antibodies
  • Description

    Rabbit polyclonal to PSMF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Dog, Pig, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan, Bat
  • Immunogen

    Synthetic peptide corresponding to Human PSMF1 aa 221-271.
    Sequence:

    LIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPGYDDMY L


    Database link: NP_848693.2
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • 293T, HeLa, Jurkat whole cell lysate (ab7899)
  • General notes

     This product was previously labelled as Proteasome Inhibitor subunit 1 PI3 1

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH: 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab140497 was affinity purified using an epitope specific to PSMF1 immobilized on a solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cell Biology
    • Proteolysis / Ubiquitin
    • Proteasome / Ubiquitin
    • Proteasome
    • Cell Biology
    • Proteolysis / Ubiquitin
    • Protease inhibitors

Images

  • Western blot - Anti-PSMF1 antibody (ab140497)
    Western blot - Anti-PSMF1 antibody (ab140497)
    All lanes : Anti-PSMF1 antibody (ab140497) at 0.4 µg/ml

    Lane 1 : 293T whole cell lysate at 50 µg
    Lane 2 : 293T whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 50 µg
    Lane 4 : Jurkat whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 30 kDa


    Exposure time: 3 minutes
  • Immunoprecipitation - Anti-PSMF1 antibody (ab140497)
    Immunoprecipitation - Anti-PSMF1 antibody (ab140497)

    ab140497 at 1 µg/ml detecting PSMF1 in 293T whole cell lysate by WB following IP.

    Lane 1: ab140497 at 6µg/mg of lysate
    Lane 2: control IgG.

    In each case, 1 mg of lysate was used for IP and 20% of the IP was loaded.

    Detection: Chemiluminescence with an exposure time of 30 seconds.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-PSMF1 antibody (ab140497)

  •  
  • Product image

    Anti-PSMF1 antibody (ab140527)

    Applications: IP, WB

  •  
  • Product image

    Anti-PSMF1 antibody (ab96845)

    Applications: WB

  •  
  • Product image

    Anti-PSMF1 antibody (ab187200)

    Applications: IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Human BMP-4 ELISA Kit (ab231930)

  •  
  • Product image

    Anti-Draxin antibody (ab117452)

  •  
  • Product image

    Anti-AASS antibody (ab231710)

  •  
  • Product image

    Anti-VDAC2 antibody (ab37985)

  •  
  • Product image

    Anti-TPH2 antibody (ab121013)

  •  
  • Product image

    Anti-KCHIP1 antibody (ab229013)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.