Anti-PSF3 antibody (ab177515)
Key features and details
- Rabbit polyclonal to PSF3
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PSF3 antibody
See all PSF3 primary antibodies -
Description
Rabbit polyclonal to PSF3 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human
-
Immunogen
Synthetic peptide within Human PSF3 aa 166-216. The exact sequence is proprietary. (NP_073607.2).
Sequence:ARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDME D
Database link: Q9BRX5 -
Positive control
- 293T, HeLa and Jurkat whole cell lysates.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab177515 was affinity purified using an epitope specific to PSF3 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunoprecipitation - Anti-PSF3 antibody (ab177515)
Detection of PSF3 in Immunoprecipitates of 293T whole cell lysate (1 mg for IP, 20% of IP loaded) using ab177515 at 6 µg/mg lysate for IP and at 0.1 µg/ml for subsequent western blot detection. Lane 2 represents control IgG IP.
Detection: Chemiluminescence with an exposure time of 3 minutes.
-
Western blot - Anti-PSF3 antibody (ab177515)All lanes : Anti-PSF3 antibody (ab177515) at 0.1 µg/ml
Lane 1 : 293T whole cell lysate
Lane 2 : HeLa whole cell lysate
Lane 3 : Jurkat whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 24 kDa
Exposure time: 3 minutes
