Anti-Proteasome 19S S5A/ASF antibody (ab140689)
Key features and details
- Rabbit polyclonal to Proteasome 19S S5A/ASF
- Suitable for: WB, IP, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Proteasome 19S S5A/ASF antibody
See all Proteasome 19S S5A/ASF primary antibodies -
Description
Rabbit polyclonal to Proteasome 19S S5A/ASF -
Host species
Rabbit -
Tested applications
Suitable for: WB, IP, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rat, Sheep, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Turkey, Pig, Xenopus laevis, Chimpanzee, Non human primates, Zebrafish, Rhesus monkey, Gorilla, Orangutan, Xenopus tropicalis -
Immunogen
Synthetic peptide corresponding to Human Proteasome 19S S5A/ASF aa 327-377.
Sequence:DVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLASQATKDGKKDKKEEDK K
Database link: NP_002801.1 -
Positive control
- 293T, HeLa and Jurkat whole cell lysate.
-
General notes
Previously labelled as Proteasome 19S S5A.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7-8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antibody concentration was determined by extinction coefficient: absorbance at 280 nm of 1.4 equals 1.0 mg of IgG. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-Proteasome 19S S5A/ASF antibody (ab140689) at 0.1 µg/ml
Lane 1 : Whole cell lysate prepared from 293T cells at 50 µg
Lane 2 : Whole cell lysate prepared from 293T cells at 15 µg
Lane 3 : Whole cell lysate prepared from HeLa cells at 50 µg
Lane 4 : Whole cell lysate prepared from Jurkat cells at 50 µg
Developed using the ECL technique.
Predicted band size: 40 kDa
Exposure time: 10 seconds
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung carcinoma tissue labelling Proteasome 19S S5A/ASF with ab140689 at 1/5000 (0.2µg/ml). Detection: DAB.
-
ab140689 at 1 µg/ml detecting Human Proteasome 19S S5A/ASF in 293T whole cell lysate by WB following IP.
Lane 1: IP with an antibody which recognizes a different epitope of Human Proteasome 19S S5A/ASF.
Lane 2: ab140689 at 6 µg/mg of lysate.
Lane 3: Control IgG.
In each case, 1 mg of lysate was used for IP and 20% of the IP was loaded.
Detection: Chemiluminescence with an exposure time of 3 seconds