Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cell Biology Proteolysis / Ubiquitin Proteasome / Ubiquitin Proteasome

Anti-Proteasome 19S S5A/ASF antibody (ab140689)

Anti-Proteasome 19S S5A/ASF antibody (ab140689)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to Proteasome 19S S5A/ASF
  • Suitable for: WB, IP, IHC-P
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Product image
Human PSMD10 (Gankyrin) knockout HeLa cell lysate (ab258146)
Product image
Recombinant Human Proteasome 19S S5A/ASF protein (ab207950)
Product image
Human PSMB8 knockout A549 cell pellet (ab279223)
Product image
Anti-PSMA3 antibody (ab264307)

Overview

  • Product name

    Anti-Proteasome 19S S5A/ASF antibody
    See all Proteasome 19S S5A/ASF primary antibodies
  • Description

    Rabbit polyclonal to Proteasome 19S S5A/ASF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Sheep, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Turkey, Pig, Xenopus laevis, Chimpanzee, Non human primates, Zebrafish, Rhesus monkey, Gorilla, Orangutan, Xenopus tropicalis
  • Immunogen

    Synthetic peptide corresponding to Human Proteasome 19S S5A/ASF aa 327-377.
    Sequence:

    DVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLASQATKDGKKDKKEEDK K


    Database link: NP_002801.1
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • 293T, HeLa and Jurkat whole cell lysate.
  • General notes

    Previously labelled as Proteasome 19S S5A. 

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C.
  • Storage buffer

    pH: 7
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antibody concentration was determined by extinction coefficient: absorbance at 280 nm of 1.4 equals 1.0 mg of IgG.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cell Biology
    • Proteolysis / Ubiquitin
    • Proteasome / Ubiquitin
    • Proteasome

Images

  • Western blot - Anti-Proteasome 19S S5A/ASF antibody (ab140689)
    Western blot - Anti-Proteasome 19S S5A/ASF antibody (ab140689)
    All lanes : Anti-Proteasome 19S S5A/ASF antibody (ab140689) at 0.1 µg/ml

    Lane 1 : Whole cell lysate prepared from 293T cells at 50 µg
    Lane 2 : Whole cell lysate prepared from 293T cells at 15 µg
    Lane 3 : Whole cell lysate prepared from HeLa cells at 50 µg
    Lane 4 : Whole cell lysate prepared from Jurkat cells at 50 µg

    Developed using the ECL technique.

    Predicted band size: 40 kDa


    Exposure time: 10 seconds
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Proteasome 19S S5A/ASF antibody (ab140689)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Proteasome 19S S5A/ASF antibody (ab140689)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung carcinoma tissue labelling Proteasome 19S S5A/ASF with ab140689 at 1/5000 (0.2µg/ml). Detection: DAB.

  • Immunoprecipitation - Anti-Proteasome 19S S5A/ASF antibody (ab140689)
    Immunoprecipitation - Anti-Proteasome 19S S5A/ASF antibody (ab140689)

    ab140689 at 1 µg/ml detecting Human Proteasome 19S S5A/ASF in 293T whole cell lysate by WB following IP.

    Lane 1: IP with an antibody which recognizes a different epitope of Human Proteasome 19S S5A/ASF.
    Lane 2: ab140689 at 6 µg/mg of lysate.
    Lane 3: Control IgG.

    In each case, 1 mg of lysate was used for IP and 20% of the IP was loaded.

    Detection: Chemiluminescence with an exposure time of 3 seconds

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Proteasome 19S S5A/ASF antibody (ab140689)

  •  
  • Product image

    Anti-Proteasome 19S S5A/ASF antibody (ab154935)

    Applications: ICC/IF, WB

  •  
  • Product image

    Anti-Proteasome 19S S5A/ASF antibody (ab18512)

    Applications: WB

  •  
  • Anti-Proteasome 19S S5A/ASF antibody (ab56851)

    Applications:

  •  
  • Product image

    Anti-Proteasome 19S S5A/ASF antibody [EPR8936] (ab137109)

    Applications: Flow Cyt, WB

  •  
  • Product image

    Anti-Proteasome 19S S5A/ASF antibody [AH1.1] (ab20239)

    Applications: Flow Cyt, IP

Clear all

Recently viewed products

  •  
  • Product image

    Anti-ATG12 antibody [EPR4800] (ab109491)

  •  
  • Product image

    Anti-LYVE1 antibody [EPR21771] (ab218535)

  •  
  • Product image

    Anti-MRPS15 antibody [EPR9361] (ab137070)

  •  
  • Product image

    Anti-BAP29 antibody [EPR7781] (ab129023)

  •  
  • Product image

    Anti-MRPS16 antibody [EPR8835] (ab151693)

  •  
  • Product image

    Anti-CHX10 antibody [EPR7022] (ab133636)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.