Anti-Proteasome 19S S4/PSMC1 antibody (ab140450)
Key features and details
- Rabbit polyclonal to Proteasome 19S S4/PSMC1
- Suitable for: WB, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-Proteasome 19S S4/PSMC1 antibody
See all Proteasome 19S S4/PSMC1 primary antibodies -
Description
Rabbit polyclonal to Proteasome 19S S4/PSMC1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Turkey, Pig, Xenopus laevis, Chimpanzee, Zebrafish, Rhesus monkey, Gorilla, Orangutan, Xenopus tropicalis
-
Immunogen
Synthetic peptide corresponding to Human Proteasome 19S S4/PSMC1 aa 390-440.
Sequence:LSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLY L
Database link: NP_002793.2 -
Positive control
- 293T, HeLa, Jurkat and NIH3T3 whole cell lysates.
-
General notes
This product was previously labelled as Proteasome 19S S4
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7-8 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab140450 was affinity purified using an epitope specific to Proteasome 19S S4/PSMC1 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-Proteasome 19S S4/PSMC1 antibody (ab140450) at 0.1 µg/ml
Lane 1 : 293T whole cell lysate at 50 µg
Lane 2 : 293T whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 50 µg
Lane 4 : Jurkat whole cell lysate at 50 µg
Lane 5 : NIH 3T3 whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 49 kDa
Exposure time: 3 minutes
-
Detection of Proteasome 19S S4/PSMC1 in Immunoprecipitates of 293T whole cell lysates (1 mg for IP, 20% of IP loaded) using ab140450 at 6 µg/mg lysate for IP and 1µg/ml for WB detection (Lane 1). Lane 2 represents control IgG IP. Detection: Chemiluminescence with an exposure time of 10 seconds.

