Anti-PGAM5 antibody (ab126534)
Key features and details
- Rabbit polyclonal to PGAM5
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PGAM5 antibody
See all PGAM5 primary antibodies -
Description
Rabbit polyclonal to PGAM5 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human PGAM5 aa 61-146.
Sequence:NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHV DGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV
Database link: Q96HS1 -
Positive control
- ICC: MCF-7 whole cells; WB: RT-4 whole cell lysates transfected with siRNA; IHC-P: Human liver, testis, tonsil and colon tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Western blot - Anti-PGAM5 antibody (ab126534)All lanes : Anti-PGAM5 antibody (ab126534) at 0.4 µg/ml
Lane 1 : Control siRNA transfected into RT4 (Human urinary bladder cancer cell line) whole cell lysate
Lane 2 : siRNA probe #1 transfected into RT4 whole cell lysate
Lane 3 : siRNA probe #2 transfected into RT4 whole cell lysate
Predicted band size: 32 kDaLoading control: Anti-PPIB
Genetic validation in WB by siRNA knockdown.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)Immunohistochemical analysis of human colon tissue labeling PGAM5 in the granular cytoplasm of glandular cells with ab126534 at a 1/200 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunocytochemistry/ Immunofluorescence - Anti-PGAM5 antibody (ab126534)Immunocytochemical analysis of MCF7 (Human breast adenocarcinoma cell line) whole cells labeling PGAM5 in the mitochondria with ab126534 2 µg/ml.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)Immunohistochemical analysis of human liver tissue labeling PGAM5 in the granular cytoplasm of hepatocytes with ab126534 at a 1/200 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)Immunohistochemical analysis of human tonsil tissue labeling PGAM5 in the granular cytoplasm of germinal center cells with ab126534 at a 1/200 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)Immunohistochemical analysis of human testis tissue labeling PGAM5 in the granular cytoplasm of cells in seminiferous ducts with ab126534 at a 1/200 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
