Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Protein Phosphorylation Ser / Thr Phosphatases

Anti-PGAM5 antibody (ab126534)

Price and availability

381 945 ₸

Availability

Order now and get it on Thursday October 13, 2022

Anti-PGAM5 antibody (ab126534)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to PGAM5
  • Suitable for: ICC/IF, WB, IHC-P
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Anti-SUV420h1 antibody (ab104875)
Product image
Anti-PP2A-alpha antibody - BSA and Azide free (Capture) (ab242579)
Product image
Human PPP1R15B knockout HeLa cell lysate (ab263309)
Product image
Recombinant Human PME-1 protein (ab109945)

Overview

  • Product name

    Anti-PGAM5 antibody
    See all PGAM5 primary antibodies
  • Description

    Rabbit polyclonal to PGAM5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PGAM5 aa 61-146.
    Sequence:

    NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHV DGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV


    Database link: Q96HS1
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • ICC: MCF-7 whole cells; WB: RT-4 whole cell lysates transfected with siRNA; IHC-P: Human liver, testis, tonsil and colon tissue.
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Protein Phosphorylation
    • Ser / Thr Phosphatases

Images

  • Western blot - Anti-PGAM5 antibody (ab126534)
    Western blot - Anti-PGAM5 antibody (ab126534)
    All lanes : Anti-PGAM5 antibody (ab126534) at 0.4 µg/ml

    Lane 1 : Control siRNA transfected into RT4 (Human urinary bladder cancer cell line) whole cell lysate
    Lane 2 : siRNA probe #1 transfected into RT4 whole cell lysate
    Lane 3 : siRNA probe #2 transfected into RT4 whole cell lysate

    Predicted band size: 32 kDa



    Loading control: Anti-PPIB

    Genetic validation in WB by siRNA knockdown.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)

    Immunohistochemical analysis of human colon tissue labeling PGAM5 in the granular cytoplasm of glandular cells with ab126534 at a 1/200 dilution.

    Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

  • Immunocytochemistry/ Immunofluorescence - Anti-PGAM5 antibody (ab126534)
    Immunocytochemistry/ Immunofluorescence - Anti-PGAM5 antibody (ab126534)

    Immunocytochemical analysis of MCF7 (Human breast adenocarcinoma cell line) whole cells labeling PGAM5 in the mitochondria with  ab126534 2 µg/ml. 

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)

    Immunohistochemical analysis of human liver tissue labeling PGAM5 in the granular cytoplasm of hepatocytes with ab126534 at a 1/200 dilution.

    Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)

    Immunohistochemical analysis of human tonsil tissue labeling PGAM5 in the granular cytoplasm of germinal center cells with ab126534 at a 1/200 dilution.

    Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)

    Immunohistochemical analysis of human testis tissue labeling PGAM5 in the granular cytoplasm of cells in seminiferous ducts with ab126534 at a 1/200 dilution.

    Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-PGAM5 antibody (ab126534)

  •  
  • Product image

    Anti-PGAM5 antibody (ab227514)

    Applications: WB

  •  
  • Product image

    Anti-PGAM5 antibody [CL0624] (ab244218)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-PGAM5 antibody (ab131552)

    Applications: ICC/IF, IHC-P, WB

Clear all

Recently viewed products

  •  
  • Recombinant Chicken IL-8 protein (ab222163)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.