Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category

Anti-Pericentrin 1/FROUNT antibody (ab176801)

Price and availability

278 083 ₸

Availability

Order now and get it on Thursday March 04, 2021

Anti-Pericentrin 1/FROUNT antibody (ab176801)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to Pericentrin 1/FROUNT
  • Suitable for: WB, IP
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-CDC42 antibody [EPR15620] - BSA and Azide free (ab271953)
Product image
Anti-Adipose Triglyceride Lipase antibody - BSA and Azide free (Capture) (ab272317)
Product image
Anti-Cytokeratin 18 antibody - BSA and Azide free (Detector) (ab259518)
Product image
Anti-CCNI2 antibody (ab97767)

Overview

  • Product name

    Anti-Pericentrin 1/FROUNT antibody
    See all Pericentrin 1/FROUNT primary antibodies
  • Description

    Rabbit polyclonal to Pericentrin 1/FROUNT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human Pericentrin 1/FROUNT aa 1-50. The exact sequence is proprietary. (NP_079120.1).
    Sequence:

    MEELDGEPTVTLIPGVNSKKNQMYFDWGPGEMLVCETSFNKKEKSEMVPS


    Database link: Q9BW27
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • 293T, HeLa, Jurkat, TCMK-1 and NIH 3T3 whole cell lysates.
  • General notes

    Protein previously labeled as Pericentrin 1.

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab176801 was affinity purified using an epitope specific to Pericentrin 1/FROUNT immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Tags & Cell Markers
    • Subcellular Markers
    • Organelles
    • Centrosome

Images

  • Western blot - Anti-Pericentrin 1/FROUNT antibody (ab176801)
    Western blot - Anti-Pericentrin 1/FROUNT antibody (ab176801)
    All lanes : Anti-Pericentrin 1/FROUNT antibody (ab176801) at 0.1 µg/ml

    Lane 1 : 293T whole cell lysate
    Lane 2 : HeLa whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK-1 whole cell lysate
    Lane 5 : NIH 3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 75 kDa


    Exposure time: 3 minutes
  • Immunoprecipitation - Anti-Pericentrin 1/FROUNT antibody (ab176801)
    Immunoprecipitation - Anti-Pericentrin 1/FROUNT antibody (ab176801)

    Detection of Pericentrin 1 in Immunoprecipitates of 293T whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176801 at 6 µg/mg lysate for IP (Lane 1) and at 1 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.

    Detection: Chemiluminescence with an exposure time of 10 seconds..

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Pericentrin 1/FROUNT antibody (ab176801)

  •  
  • Product image

    Anti-Pericentrin 1/FROUNT antibody (ab19044)

    Applications: WB

  •  
  • Product image

    Anti-Pericentrin 1/FROUNT antibody (ab231958)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-Pericentrin 1/FROUNT antibody (ab168839)

    Applications: IP, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-HCN2 antibody [S71] (ab84817)

  •  
  • Product image

    Anti-CEACAM6 antibody [9A6] (ab78029)

  •  
  • Product image

    Anti-GSTK1 antibody (ab229219)

  •  
  • Product image

    Anti-GDNF antibody (ab119473)

  •  
  • Product image

    Anti-APOA1BP antibody (ab199130)

  •  
  • Goat Anti-Mouse IgG H&L (PE) preadsorbed (ab97041)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.