Anti-Pericentrin 1/FROUNT antibody (ab176801)
Key features and details
- Rabbit polyclonal to Pericentrin 1/FROUNT
- Suitable for: WB, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-Pericentrin 1/FROUNT antibody
See all Pericentrin 1/FROUNT primary antibodies -
Description
Rabbit polyclonal to Pericentrin 1/FROUNT -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan -
Immunogen
Synthetic peptide within Human Pericentrin 1/FROUNT aa 1-50. The exact sequence is proprietary. (NP_079120.1).
Sequence:MEELDGEPTVTLIPGVNSKKNQMYFDWGPGEMLVCETSFNKKEKSEMVPS
Database link: Q9BW27 -
Positive control
- 293T, HeLa, Jurkat, TCMK-1 and NIH 3T3 whole cell lysates.
-
General notes
Protein previously labeled as Pericentrin 1.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab176801 was affinity purified using an epitope specific to Pericentrin 1/FROUNT immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-Pericentrin 1/FROUNT antibody (ab176801) at 0.1 µg/ml
Lane 1 : 293T whole cell lysate
Lane 2 : HeLa whole cell lysate
Lane 3 : Jurkat whole cell lysate
Lane 4 : TCMK-1 whole cell lysate
Lane 5 : NIH 3T3 whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 75 kDa
Exposure time: 3 minutes
-
Detection of Pericentrin 1 in Immunoprecipitates of 293T whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176801 at 6 µg/mg lysate for IP (Lane 1) and at 1 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.
Detection: Chemiluminescence with an exposure time of 10 seconds..