Anti-p170 antibody (ab151139)
Key features and details
- Rabbit polyclonal to p170
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-p170 antibody -
Description
Rabbit polyclonal to p170 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human p170 aa 1155-1258.
Sequence:LPCRPFDTVFIFYMKPGQKTNQEILKNVESSRTVQPHFLEFLLSLGWSVD VGRHPGWTGHVSTSWSINCCDDGEGSQQEVISSEDIGASIFNGQKKVLYY ADAL
Database link: Q86X10 -
Positive control
- IHC-P: Human cerebellum, testis, urinary bladder, skeletal muscle tissue ICC/IF: Caco-2 cells
-
General notes
Previously labelled as RALGAPB.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Paraffin embedded human cerebellum tissue stained for p170 using ab151139 at 1/200 dilution in immunohistochemical analysis.
Heat mediated antigen retrieval was performed with citrate buffer pH 6 before the IHC staining protocol.
-
Caco-2 cells stained for p170 (green) using ab151139 at 2 µg/ml dilution in ICC/IF.
-
Paraffin embedded human testis tissue stained for p170 using ab151139 at 1/200 dilution in immunohistochemical analysis.
Heat mediated antigen retrieval was performed with citrate buffer pH 6 before the IHC staining protocol.
-
Paraffin embedded human urinary bladder tissue stained for p170 using ab151139 at 1/200 dilution in immunohistochemical analysis.
Heat mediated antigen retrieval was performed with citrate buffer pH 6 before the IHC staining protocol.
-
Paraffin embedded human skeletal muscle tissue stained for p170 using ab151139 at 1/200 dilution in immunohistochemical analysis.
Heat mediated antigen retrieval was performed with citrate buffer pH 6 before the IHC staining protocol.