Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Signaling Pathway G Protein Signaling Small G Proteins Regulators

Anti-p170 antibody (ab151139)

Anti-p170 antibody (ab151139)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to p170
  • Suitable for: ICC/IF, IHC-P
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-RGS7 antibody (ab228618)
Product image
Anti-IPCEF1 antibody - BSA and Azide free (Capture) (ab242602)
Product image
Anti-ALS2CL antibody (ab187986)
Product image
Anti-RASA1 antibody [EP536Y] - BSA and Azide free (ab247281)

Overview

  • Product name

    Anti-p170 antibody
  • Description

    Rabbit polyclonal to p170
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human p170 aa 1155-1258.
    Sequence:

    LPCRPFDTVFIFYMKPGQKTNQEILKNVESSRTVQPHFLEFLLSLGWSVD VGRHPGWTGHVSTSWSINCCDDGEGSQQEVISSEDIGASIFNGQKKVLYY ADAL


    Database link: Q86X10
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • IHC-P: Human cerebellum, testis, urinary bladder, skeletal muscle tissue ICC/IF: Caco-2 cells
  • General notes

    Previously labelled as RALGAPB. 

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine)
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Signaling Pathway
    • G Protein Signaling
    • Small G Proteins
    • Regulators
    • Signal Transduction
    • Signaling Pathway
    • G Protein Signaling
    • Small G Proteins
    • Ras Family

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p170 antibody (ab151139)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p170 antibody (ab151139)

    Paraffin embedded human cerebellum tissue stained for p170 using ab151139 at 1/200 dilution in immunohistochemical analysis.

    Heat mediated antigen retrieval was performed with citrate buffer pH 6 before the IHC staining protocol.

  • Immunocytochemistry/ Immunofluorescence - Anti-p170 antibody (ab151139)
    Immunocytochemistry/ Immunofluorescence - Anti-p170 antibody (ab151139)

    Caco-2 cells stained for p170 (green) using ab151139 at 2 µg/ml dilution in ICC/IF. 

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p170 antibody (ab151139)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p170 antibody (ab151139)

    Paraffin embedded human testis tissue stained for p170 using ab151139 at 1/200 dilution in immunohistochemical analysis.

    Heat mediated antigen retrieval was performed with citrate buffer pH 6 before the IHC staining protocol.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p170 antibody (ab151139)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p170 antibody (ab151139)

    Paraffin embedded human urinary bladder tissue stained for p170 using ab151139 at 1/200 dilution in immunohistochemical analysis.

    Heat mediated antigen retrieval was performed with citrate buffer pH 6 before the IHC staining protocol.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p170 antibody (ab151139)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p170 antibody (ab151139)

    Paraffin embedded human skeletal muscle tissue stained for p170 using ab151139 at 1/200 dilution in immunohistochemical analysis.

    Heat mediated antigen retrieval was performed with citrate buffer pH 6 before the IHC staining protocol.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Clear all

Recently viewed products

  •  
  • Product image

    Anti-KANK2 antibody (ab99351)

  •  
  • Product image

    Anti-FAM107B antibody (ab272667)

  •  
  • Product image

    Anti-IGSF10 antibody (ab197671)

  •  
  • Product image

    Anti-IQGAP3 antibody (ab88353)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.