Anti-Ovalbumin antibody (ab181688)
Key features and details
- Rabbit polyclonal to Ovalbumin
- Suitable for: WB
- Isotype: IgG
Overview
-
Product name
Anti-Ovalbumin antibody
See all Ovalbumin primary antibodies -
Description
Rabbit polyclonal to Ovalbumin -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Immunogen
Full length native protein (purified) corresponding to Chicken Ovalbumin aa 2-386. (Purified from Hen Egg White).
Sequence:GSIGAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKDSTR TQINKVVRFDKLPGFGDSIEAQCGTSVNVHSSLRDILNQITKPNDVYSFS LASRLYAEERYPILPEYLQCVKELYRGGLEPINFQTAADQARELINSWVE SQTNGIIRNVLQPSSVDSQTAMVLVNAIVFKGLWEKAFKDEDTQAMPFRV TEQESKPVQMMYQIGLFRVASMASEKMKILELPFASGTMSMLVLLPDEVS GLEQLESIINFEKLTEWTSSNVMEERKIKVYLPRMKMEEKYNLTSVLMAM GITDVFSSSANLSGISSAESLKISQAVHAAHAEINEAGREVVGSAEAGVD AASVSEEFRADHPFLFCIKHIATNAVLFFGRCVSP
Database link: P01012 -
Positive control
- Ovalbumin protein.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.01% Sodium azide
Constituents: 0.27% Potassium phosphate, 0.88% Sodium chloride -
Concentration information loading... -
Purity
IgG fraction -
Purification notes
ab181688 is an IgG fraction antibody purified from monospecific antiserum by a multi-step process which includes delipidation, salt fractionation and ion exchange chromatography followed by extensive dialysis against the buffer stated above. ab181688 is sterile filtered. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Anti-Ovalbumin antibody (ab181688) at 1/1000 dilution (overnight at 4°C) + Reduced Ovalbumin at 0.005 µg
Secondary
Peroxidase rabbit secondary antibody
30 min at RT at 1/40000 dilution
Predicted band size: 43 kDa
Observed band size: 45 kDa why is the actual band size different from the predicted?
-
All lanes : Anti-Ovalbumin antibody (ab181688) at 1/5000 dilution
Lanes 1 & 3 : Ovalbumin protein at 1 µg
Lanes 2 & 4 : Ovalbumin protein at 0.25 µg
Secondary
All lanes : Atto 425 conjugated goat anti rabbit secondary antibody at 1/10000 dilution
Predicted band size: 43 kDa
Observed band size: 36 kDa why is the actual band size different from the predicted?Lane 1 + 2 under reducing conditions; Lane 3 + 4 under non-reducing conditions.

