Anti-Osteopontin antibody [7C5H12] (ab166709)
Key features and details
- Mouse monoclonal [7C5H12] to Osteopontin
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-Osteopontin antibody [7C5H12]
See all Osteopontin primary antibodies -
Description
Mouse monoclonal [7C5H12] to Osteopontin -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee -
Immunogen
Recombinant fragment corresponding to Human Osteopontin aa 167-314.
Sequence:LRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQDLNAPSD WDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQEL SKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN
Database link: P10451 -
Positive control
- Human recombinant Osteopontin protein; HEK293 cells transfected with recombinant Human Osteopontin fragment (amino acids 167-314); Human prostate cancer, endometrial cancer and pancreas tissues.
-
General notes
This product was changed from ascites to supernatant. Lot no’s high than GR206348-21 are from Tissue Culture Supernatant
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
7C5H12 -
Isotype
IgG1 -
Research areas
Images
-
All lanes : Anti-Osteopontin antibody [7C5H12] (ab166709) at 1/500 dilution
Lane 1 : HEK293 cell lysate
Lane 2 : HEK293 cell lysate, transfected with recombinant Human Osteopontin fragment (amino acids 167-314)
Predicted band size: 35 kDa
-
ab166709 staining Osteopontin in human colon (smooth muscle cells) tissue sections by Immunohistochemistry (IHC-P - paraformaldehyde-fixed, paraffin-embedded sections). Tissue was fixed with formaldehyde, permeabilized with 0.2% Triton X-100 in PBS and blocked with 5% milk for 30 minutes at room temperature; antigen retrieval was by heat mediation in Tris pH 9.0. Samples were incubated with primary antibody (1/100 in PBS) for 16 hours at 4°C. An undiluted Biotin-conjugated horse anti-mouse IgG polyclonal was used as the secondary antibody.
-
Anti-Osteopontin antibody [7C5H12] (ab166709) at 1/500 dilution + recombinant Human Osteopontin protein
Predicted band size: 35 kDa
-
Immunohistochemical analysis of paraffin embedded, DAB-stained Human prostate cancer tissue labeling Osteopontin using ab166709 at a 1/200 dilution.
-
Immunohistochemical analysis of paraffin embedded, DAB-stained Human endometrial cancer tissue, labeling Osteopontin using ab166709 at a 1/200 dilution.
-
Formalin-fixed, paraffin-embedded human pancreas tissue stained for Osteopontin using ab166709 at 1/100 dilution in immunohistochemical analysis.