Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Cytoskeleton / ECM Extracellular Matrix

Anti-Osteopontin antibody [7C5H12] (ab166709)

Price and availability

268 032 ₸

Availability

Order now and get it on Wednesday February 24, 2021

Anti-Osteopontin antibody [7C5H12] (ab166709)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [7C5H12] to Osteopontin
  • Suitable for: WB, IHC-P
  • Reacts with: Human
  • Isotype: IgG1

You may also be interested in

Product image
Human RPSA Antibody Pair - BSA and Azide free (ab253550)
Product image
Alexa Fluor® 647 Anti-Fibronectin antibody [EPR19241-46] (ab237287)
Product image
Rat Osteopontin ELISA kit (ab205076)
Product image
Anti-Fibronectin antibody [F14] (ab45688)

Overview

  • Product name

    Anti-Osteopontin antibody [7C5H12]
    See all Osteopontin primary antibodies
  • Description

    Mouse monoclonal [7C5H12] to Osteopontin
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Human Osteopontin aa 167-314.
    Sequence:

    LRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQDLNAPSD WDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQEL SKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN


    Database link: P10451
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Human recombinant Osteopontin protein; HEK293 cells transfected with recombinant Human Osteopontin fragment (amino acids 167-314); Human prostate cancer, endometrial cancer and pancreas tissues.
  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR206348-21 are from Tissue Culture Supernatant

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    7C5H12
  • Isotype

    IgG1
  • Research areas

    • Cardiovascular
    • Angiogenesis
    • Adhesion / ECM
    • Extracellular Matrix
    • Signal Transduction
    • Cytoskeleton / ECM
    • Extracellular Matrix
    • Structures
    • Bone
    • Stem Cells
    • Mesenchymal Stem Cells
    • Osteogenesis
    • Cancer
    • Tumor biomarkers
    • Other

Images

  • Western blot - Anti-Osteopontin antibody [7C5H12] (ab166709)
    Western blot - Anti-Osteopontin antibody [7C5H12] (ab166709)
    All lanes : Anti-Osteopontin antibody [7C5H12] (ab166709) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : HEK293 cell lysate, transfected with recombinant Human Osteopontin fragment (amino acids 167-314)

    Predicted band size: 35 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Osteopontin antibody [7C5H12] (ab166709)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Osteopontin antibody [7C5H12] (ab166709) This image is courtesy of an Abreview submitted by Steffen Rickelt

    ab166709 staining Osteopontin in human colon (smooth muscle cells) tissue sections by Immunohistochemistry (IHC-P - paraformaldehyde-fixed, paraffin-embedded sections). Tissue was fixed with formaldehyde, permeabilized with 0.2% Triton X-100 in PBS and blocked with 5% milk for 30 minutes at room temperature; antigen retrieval was by heat mediation in Tris pH 9.0. Samples were incubated with primary antibody (1/100 in PBS) for 16 hours at 4°C. An undiluted Biotin-conjugated horse anti-mouse IgG polyclonal was used as the secondary antibody.

    See Abreview

  • Western blot - Anti-Osteopontin antibody [7C5H12] (ab166709)
    Western blot - Anti-Osteopontin antibody [7C5H12] (ab166709)
    Anti-Osteopontin antibody [7C5H12] (ab166709) at 1/500 dilution + recombinant Human Osteopontin protein

    Predicted band size: 35 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Osteopontin antibody [7C5H12] (ab166709)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Osteopontin antibody [7C5H12] (ab166709)
    Immunohistochemical analysis of paraffin embedded, DAB-stained Human prostate cancer tissue labeling Osteopontin using ab166709 at a 1/200 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Osteopontin antibody [7C5H12] (ab166709)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Osteopontin antibody [7C5H12] (ab166709)
    Immunohistochemical analysis of paraffin embedded, DAB-stained Human endometrial cancer tissue, labeling Osteopontin using ab166709 at a 1/200 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Osteopontin antibody [7C5H12] (ab166709)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Osteopontin antibody [7C5H12] (ab166709) This image is courtesy of an Abreview submitted by Mrs. Maria Cecilia Ybanez.

    Formalin-fixed, paraffin-embedded human pancreas tissue stained for Osteopontin using ab166709 at 1/100 dilution in immunohistochemical analysis.

    See Abreview

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Osteopontin antibody [7C5H12] (ab166709)

  •  
  • Product image

    Anti-Osteopontin antibody [EPR21139-316] - BSA and Azide free (ab236213)

    Applications: IHC-P, IP, WB

  •  
  • Product image

    Anti-Osteopontin antibody (ab8448)

    Applications: ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-Osteopontin antibody [EPR21138] - BSA and Azide free (ab229854)

    Applications: IHC-P

  •  
  • Product image

    Anti-Osteopontin antibody [EPR21138] (ab218237)

    Applications: IHC-P

  •  
  • Product image

    Anti-Osteopontin antibody [53] (ab69498)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-Osteopontin antibody [EPR21139-316] (ab214050)

    Applications: IHC-P, IP, WB

  •  
  • Product image

    Anti-Osteopontin antibody (ab63856)

    Applications: ICC/IF, IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    FITC Anti-EGFR antibody [ICR10] (ab11400)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.