Anti-Ornithine Carbamoyltransferase/OTC antibody [OTI8A1] (ab180401)
Key features and details
- Mouse monoclonal [OTI8A1] to Ornithine Carbamoyltransferase/OTC
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-Ornithine Carbamoyltransferase/OTC antibody [OTI8A1]
See all Ornithine Carbamoyltransferase/OTC primary antibodies -
Description
Mouse monoclonal [OTI8A1] to Ornithine Carbamoyltransferase/OTC -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow -
Immunogen
Recombinant full length protein corresponding to Human Ornithine Carbamoyltransferase/OTC aa 33-354. Mitochondrial Ornithine carbamoyltransferase (NP_000522)
Sequence:NKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQKGEYLPLLQGKSL GMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLTDTARVLS SMADAVLARVYKQSDLDTLAKEASIPIINGLSDLYHPIQILADYLTLQEH YSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKL AEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQ GYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKW TIMAVMVSLLTDYSPQLQKPKF
Database link: P00480 -
Positive control
- Ornithine Carbamoyltransferase/OTC transfected HEK293T cell lysate.
-
General notes
The clone number has been updated from 8A1 to OTI8A1, both clone numbers name the same clone.
This product was changed from ascites to tissue culture supernatant on 29th May 2018. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
Previously labelled as Ornithine Carbamoyltransferase.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 48% PBS, 50% Glycerol, 1% BSA -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from TCS -
Clonality
Monoclonal -
Clone number
OTI8A1 -
Isotype
IgG1 -
Research areas
Images
-
All lanes : Anti-Ornithine Carbamoyltransferase/OTC antibody [OTI8A1] (ab180401) at 1/2000 dilution
Lane 1 : Non-transfected HEK293T cell lysate
Lane 2 : Lysate of HEK293T cells transfected with the pCMV6-ENTRY Ornithine Carbamoyltransferase / OTC cDNA.
Predicted band size: 39 kDa
HEK293T cell lysates were generated from transient transfection of the cDNA clone (RC221568)