Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Immunology Immune System Diseases Antiviral Signaling

Anti-NDP52 antibody [OTI4H5] (ab124372)

Price and availability

278 083 ₸

Availability

Order now and get it on Wednesday March 17, 2021

Anti-NDP52 antibody [OTI4H5] (ab124372)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [OTI4H5] to NDP52
  • Suitable for: WB, Flow Cyt, ICC/IF
  • Reacts with: Mouse, Dog, Human, African green monkey
  • Isotype: IgG1

You may also be interested in

Product image
Recombinant Human HERVK18.2 protein (ab114906)
Anti-DEFB-4 antibody (ab70215)
Recombinant Human beta 5 Defensin protein (ab190997)
Biotin Anti-DEFB-4 antibody (ab70216)

Overview

  • Product name

    Anti-NDP52 antibody [OTI4H5]
    See all NDP52 primary antibodies
  • Description

    Mouse monoclonal [OTI4H5] to NDP52
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    Flow Cyt
    Human
    ICC/IF
    African green monkey
    WB
    Human
    See all applications and species data
  • Immunogen

    Recombinant full length protein corresponding to Human NDP52 aa 1-446. Produced in HEK-293T cells (NP_005822).
    Sequence:

    MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIP RRKDWIGIFRVGWKTTREYYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPK DDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNK ELCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKE QKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQG DQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQ QELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLLSYMG LDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPIC KADDICDHTLEQQQMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL


    Database link: Q13137
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY NDP52 cDNA; HeLa, A549, COS-7, Jurkat and MCF7 cell extracts; Human testis, omentum, uterus, breast, brain, liver, ovary, thyroid gland and colon lysate. ICC/IF: COS-7 cells transiently transfected by NDP52 cDNA. Flow Cyt: HeLa and Jurkat cells; HEK-293T cells transfected with pCMV6-ENTRY NDP52.
  • General notes

    Clone OTI4H5 (formerly 4H5).

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

    One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

    Learn more here.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI4H5
  • Isotype

    IgG1
  • Research areas

    • Immunology
    • Immune System Diseases
    • Antiviral Signaling

Images

  • Immunocytochemistry/ Immunofluorescence - Anti-NDP52 antibody [OTI4H5] (ab124372)
    Immunocytochemistry/ Immunofluorescence - Anti-NDP52 antibody [OTI4H5] (ab124372)

    COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY NDP52, labeling NDP52 using ab124372 at dilution 1/100 dilution in ICC/IF.

  • Western blot - Anti-NDP52 antibody [OTI4H5] (ab124372)
    Western blot - Anti-NDP52 antibody [OTI4H5] (ab124372)
    All lanes : Anti-NDP52 antibody [OTI4H5] (ab124372) at 1/500 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY NDP52 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 52 kDa

  • Western blot - Anti-NDP52 antibody [OTI4H5] (ab124372)
    Western blot - Anti-NDP52 antibody [OTI4H5] (ab124372)
    All lanes : Anti-NDP52 antibody [OTI4H5] (ab124372) at 1/500 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
    Lane 3 : SVT2 cell extract
    Lane 4 : A549 (human lung carcinoma cell line) cell extract
    Lane 5 : COS-7 (African green monkey kidney fibroblast-like cell line) cell extract
    Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
    Lane 7 : MDCK (Canine kidney cell line) cell extract
    Lane 8 : PC-12 (Rat adrenal gland pheochromocytoma cell line) cell extract
    Lane 9 : MCF7 (Human breast adenocarcinoma cell line) cell extract

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 52 kDa

  • Flow Cytometry - Anti-NDP52 antibody [OTI4H5] (ab124372)
    Flow Cytometry - Anti-NDP52 antibody [OTI4H5] (ab124372)

    Flow cytometric analysis of HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with either NDP52 overexpress plasmid (Red) or empty vector control plasmid (Blue) labeling NDP52 with ab124372 at 1/100 dilution.

  • Western blot - Anti-NDP52 antibody [OTI4H5] (ab124372)
    Western blot - Anti-NDP52 antibody [OTI4H5] (ab124372)
    All lanes : Anti-NDP52 antibody [OTI4H5] (ab124372) at 1/500 dilution

    Lane 1 : Human testis extract
    Lane 2 : Human omentum extract
    Lane 3 : Human uterus extract
    Lane 4 : Human breast extract
    Lane 5 : Human brain extract
    Lane 6 : Human liver extract
    Lane 7 : Human ovary extract
    Lane 8 : Human thyroid gland extract
    Lane 9 : Human colon extract

    Lysates/proteins at 10 µg per lane.

    Predicted band size: 52 kDa

  • Flow Cytometry - Anti-NDP52 antibody [OTI4H5] (ab124372)
    Flow Cytometry - Anti-NDP52 antibody [OTI4H5] (ab124372)

    Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling NDP52 using ab124372 at 1/100 dilution (Red), compared to a nonspecific negative control antibody (Blue).

  • Flow Cytometry - Anti-NDP52 antibody [OTI4H5] (ab124372)
    Flow Cytometry - Anti-NDP52 antibody [OTI4H5] (ab124372)

    Flow cytometric analysis of Jurkat (human T cell leukemia cell line from peripheral blood) cells labeling NDP52 using ab124372 at a dilution of 1/100 (Red), compared to a nonspecific negative control antibody (Blue).

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-NDP52 antibody [OTI4H5] (ab124372)

  •  
  • Product image

    Anti-NDP52 antibody (ab151256)

    Applications: ICC/IF, IHC-P, IP, WB

  •  
  • Product image

    Anti-NDP52 antibody (ab68588)

    Applications: ICC/IF, IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Alcohol Dehydrogenase antibody [EPR4439] (ab108203)

  •  
  • Product image

    Anti-SBDS antibody [EPR7820] (ab128946)

  •  
  • Product image

    Anti-MHC Class II antibody [MRC OX-6] (ab23990)

  •  
  • Product image

    Anti-PAX8 antibody [1F8-3A8] (ab183573)

  •  
  • Rabbit F(ab')2 Anti-Dog IgG H&L (HRP) (ab136759)

  •  
  • Product image

    PE Anti-EPCR/CD201 antibody [016] (ab275631)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.