Anti-NDP52 antibody [OTI4H5] (ab124372)
Key features and details
- Mouse monoclonal [OTI4H5] to NDP52
- Suitable for: WB, Flow Cyt, ICC/IF
- Reacts with: Mouse, Dog, Human, African green monkey
- Isotype: IgG1
Overview
-
Product name
Anti-NDP52 antibody [OTI4H5]
See all NDP52 primary antibodies -
Description
Mouse monoclonal [OTI4H5] to NDP52 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanICC/IF African green monkeyWB Human -
Immunogen
Recombinant full length protein corresponding to Human NDP52 aa 1-446. Produced in HEK-293T cells (NP_005822).
Sequence:MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIP RRKDWIGIFRVGWKTTREYYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPK DDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNK ELCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKE QKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQG DQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQ QELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLLSYMG LDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPIC KADDICDHTLEQQQMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL
Database link: Q13137 -
Positive control
- WB: HEK-293T cell lysate transfected with pCMV6-ENTRY NDP52 cDNA; HeLa, A549, COS-7, Jurkat and MCF7 cell extracts; Human testis, omentum, uterus, breast, brain, liver, ovary, thyroid gland and colon lysate. ICC/IF: COS-7 cells transiently transfected by NDP52 cDNA. Flow Cyt: HeLa and Jurkat cells; HEK-293T cells transfected with pCMV6-ENTRY NDP52.
-
General notes
Clone OTI4H5 (formerly 4H5).
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol, 1% BSA -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant. -
Clonality
Monoclonal -
Clone number
OTI4H5 -
Isotype
IgG1 -
Research areas
Images
-
COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY NDP52, labeling NDP52 using ab124372 at dilution 1/100 dilution in ICC/IF.
-
All lanes : Anti-NDP52 antibody [OTI4H5] (ab124372) at 1/500 dilution
Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY NDP52 cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 52 kDa
-
All lanes : Anti-NDP52 antibody [OTI4H5] (ab124372) at 1/500 dilution
Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
Lane 3 : SVT2 cell extract
Lane 4 : A549 (human lung carcinoma cell line) cell extract
Lane 5 : COS-7 (African green monkey kidney fibroblast-like cell line) cell extract
Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
Lane 7 : MDCK (Canine kidney cell line) cell extract
Lane 8 : PC-12 (Rat adrenal gland pheochromocytoma cell line) cell extract
Lane 9 : MCF7 (Human breast adenocarcinoma cell line) cell extract
Lysates/proteins at 35 µg per lane.
Predicted band size: 52 kDa
-
Flow cytometric analysis of HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with either NDP52 overexpress plasmid (Red) or empty vector control plasmid (Blue) labeling NDP52 with ab124372 at 1/100 dilution.
-
All lanes : Anti-NDP52 antibody [OTI4H5] (ab124372) at 1/500 dilution
Lane 1 : Human testis extract
Lane 2 : Human omentum extract
Lane 3 : Human uterus extract
Lane 4 : Human breast extract
Lane 5 : Human brain extract
Lane 6 : Human liver extract
Lane 7 : Human ovary extract
Lane 8 : Human thyroid gland extract
Lane 9 : Human colon extract
Lysates/proteins at 10 µg per lane.
Predicted band size: 52 kDa
-
Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling NDP52 using ab124372 at 1/100 dilution (Red), compared to a nonspecific negative control antibody (Blue).
-
Flow cytometric analysis of Jurkat (human T cell leukemia cell line from peripheral blood) cells labeling NDP52 using ab124372 at a dilution of 1/100 (Red), compared to a nonspecific negative control antibody (Blue).