Antibodies, Proteins, Kits and Reagents for Life Science

278 083 ₸ Product size

100 µl 278 083 ₸

Order now and get it on Wednesday March 17, 2021

Key features and details

Mouse monoclonal [OTI4H5] to NDP52
Suitable for: WB, Flow Cyt, ICC/IF
Reacts with: Mouse, Dog, Human, African green monkey
Isotype: IgG1

Product name

Anti-NDP52 antibody [OTI4H5]
See all NDP52 primary antibodies
Description

Mouse monoclonal [OTI4H5] to NDP52
Host species

Mouse

Tested Applications & Species

Application	Species
Flow Cyt	Human
ICC/IF	African green monkey
WB	Human

See all applications and species data

Immunogen

Recombinant full length protein corresponding to Human NDP52 aa 1-446. Produced in HEK-293T cells (NP_005822).
Sequence:
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIP RRKDWIGIFRVGWKTTREYYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPK DDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNK ELCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKE QKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQG DQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQ QELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLLSYMG LDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPIC KADDICDHTLEQQQMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL

Database link: Q13137
Run BLAST with Run BLAST with
Positive control
- WB: HEK-293T cell lysate transfected with pCMV6-ENTRY NDP52 cDNA; HeLa, A549, COS-7, Jurkat and MCF7 cell extracts; Human testis, omentum, uterus, breast, brain, liver, ovary, thyroid gland and colon lysate. ICC/IF: COS-7 cells transiently transfected by NDP52 cDNA. Flow Cyt: HeLa and Jurkat cells; HEK-293T cells transfected with pCMV6-ENTRY NDP52.
General notes

Clone OTI4H5 (formerly 4H5).
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

Learn more here.

Form

Liquid
Storage instructions

Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
Storage buffer

pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol, 1% BSA
Concentration information loading...
Purity

Affinity purified
Purification notes

Purified from cell culture supernatant.
Clonality

Monoclonal
Clone number

OTI4H5
Isotype

IgG1
Research areas

Immunocytochemistry/ Immunofluorescence - Anti-NDP52 antibody [OTI4H5] (ab124372)

COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY NDP52, labeling NDP52 using ab124372 at dilution 1/100 dilution in ICC/IF.
Western blot - Anti-NDP52 antibody [OTI4H5] (ab124372)

All lanes : Anti-NDP52 antibody [OTI4H5] (ab124372) at 1/500 dilution

Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY NDP52 cDNA

Lysates/proteins at 5 µg per lane.

Predicted band size: 52 kDa
Western blot - Anti-NDP52 antibody [OTI4H5] (ab124372)

All lanes : Anti-NDP52 antibody [OTI4H5] (ab124372) at 1/500 dilution

Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
Lane 3 : SVT2 cell extract
Lane 4 : A549 (human lung carcinoma cell line) cell extract
Lane 5 : COS-7 (African green monkey kidney fibroblast-like cell line) cell extract
Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
Lane 7 : MDCK (Canine kidney cell line) cell extract
Lane 8 : PC-12 (Rat adrenal gland pheochromocytoma cell line) cell extract
Lane 9 : MCF7 (Human breast adenocarcinoma cell line) cell extract

Lysates/proteins at 35 µg per lane.

Predicted band size: 52 kDa
Flow Cytometry - Anti-NDP52 antibody [OTI4H5] (ab124372)

Flow cytometric analysis of HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with either NDP52 overexpress plasmid (Red) or empty vector control plasmid (Blue) labeling NDP52 with ab124372 at 1/100 dilution.
Western blot - Anti-NDP52 antibody [OTI4H5] (ab124372)

All lanes : Anti-NDP52 antibody [OTI4H5] (ab124372) at 1/500 dilution

Lane 1 : Human testis extract
Lane 2 : Human omentum extract
Lane 3 : Human uterus extract
Lane 4 : Human breast extract
Lane 5 : Human brain extract
Lane 6 : Human liver extract
Lane 7 : Human ovary extract
Lane 8 : Human thyroid gland extract
Lane 9 : Human colon extract

Lysates/proteins at 10 µg per lane.

Predicted band size: 52 kDa
Flow Cytometry - Anti-NDP52 antibody [OTI4H5] (ab124372)

Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling NDP52 using ab124372 at 1/100 dilution (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry - Anti-NDP52 antibody [OTI4H5] (ab124372)

Flow cytometric analysis of Jurkat (human T cell leukemia cell line from peripheral blood) cells labeling NDP52 using ab124372 at a dilution of 1/100 (Red), compared to a nonspecific negative control antibody (Blue).

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com