Anti-MOCOS/MCS antibody (ab151015)
Key features and details
- Rabbit polyclonal to MOCOS/MCS
- Suitable for: IHC-P, WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MOCOS/MCS antibody
See all MOCOS/MCS primary antibodies -
Description
Rabbit polyclonal to MOCOS/MCS -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human MOCOS/MCS aa 607-718.
Sequence:NQGLLYDRSWMVVNHNGVCLSQKQEPRLCLIQPFIDLRQRIMVIKAKGME PIEVPLEENSERTQIRQSRVCADRVSTYDCGEKISSWLSTFFGRPCHL IK QSSNSQRNAKKK
-
Positive control
- IHC-P: Human stomach tissue. WB: RT4 cells. ICC/IF: RT4 cells.
-
General notes
The antibody solution should be gently mixed before use.Previously labelled as MOCOS.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG
Images
-
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human stomach tissue labelling MOCOS/MCS with ab151015 at 1/50 dilution
-
All lanes :
Lane 1 : Molecular ladder
Lane 2 : RT4 cell lysate at 0.4 µg/ml
Predicted band size: 98 kDa
-
RT4 cells stained for MOCOS/MCS (green) using ab151015 at 2 µg/ml dilution in ICC/IF.