Anti-MLX-interacting protein antibody (ab176688)
Key features and details
- Rabbit polyclonal to MLX-interacting protein
- Suitable for: IP, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MLX-interacting protein antibody
See all MLX-interacting protein primary antibodies -
Description
Rabbit polyclonal to MLX-interacting protein -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human
-
Immunogen
Synthetic peptide within Human MLX-interacting protein aa 869-919. The exact sequence is proprietary. NP_055753.3.
Sequence:DQHCSLPILRPMVLSTLRQLSTSTSILTDPAQLPEQASKAVTRIGKRLGE S
Database link: Q9HAP2 -
Positive control
- HeLa, Jurkat or 293T lysate.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 0.1% BSA, 99% Tris buffered saline -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Western blot - Anti-MLX-interacting protein antibody (ab176688)All lanes : Anti-MLX-interacting protein antibody (ab176688) at 0.04 µg/ml
Lane 1 : HeLa lysate at 50 µg
Lane 2 : HeLa lysate at 15 µg
Lane 3 : Jurkat lysate at 50 µg
Lane 4 : 293T lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 101 kDa
Exposure time: 30 seconds
-
Immunoprecipitation - Anti-MLX-interacting protein antibody (ab176688)Detection of Human MLX-interacting protein by Western Blot of Immunoprecipitates. 1 mg for IP; 20% of IP HeLa whole cell lysate loaded. ab176688 used for IP at 6 µg/mg lysate. For blotting immunoprecipitated MLX-interacting protein, ab176688 was used at 0.4 µg/ml.
